Details for Arabidopsis Locus AT3G12960

Position : Chr3 ( 5`- 4136488 .. 4136828 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12960

Protein [Map View]
MAKNKDDIKYATAQAKLSEDEAIRVSYKHGTPLEGGKIAESEPVELFSSAQRIEKGKEQSAASGDQTQIQRDIKDIKGTR
TDDSPR*

DNA
ATGGCGAAGAACAAGGACGACATAAAGTATGCAACGGCTCAAGCGAAGCTATCGGAAGACGAAGCAATTCGTGTAAGCTA
CAAACACGGGACACCATTAGAGGGAGGCAAGATCGCAGAGTCGGAGCCTGTAGAGCTGTTCTCGAGTGCTCAACGTATCG
AGAAGGGAAAAGAGCAGTCAGCAGCATCCGGCGATCAAACACAGATACAACGTGACATCAAAGATATCAAGGGAACACGT
ACAGACGATAGTCCCCGCTGA