Details for Arabidopsis Locus AT3G12955

Position : Chr3 ( 5`- 4135500 .. 4136143 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12955

Protein [Map View]
MIKKMRLMMMLRRCKSVSTQLGRSYSYTSLRSKSARRDPQDHLQDVDQSPTPSMYQTVLVGRTKKPYLISKKHLKHPLLN
ALVEKQQRYEEDDNEDGSCIITVKCEVVLFDHLLWMLEYGDEVHILESLDDFAHLYLSP*

DNA
ATGATAAAGAAGATGAGGTTGATGATGATGCTCAGGAGATGCAAGAGCGTGTCCACACAATTAGGTCGTTCATATTCTTA
CACAAGTCTCAGATCCAAATCGGCCAGGAGAGATCCACAAGACCATCTCCAAGACGTTGACCAGAGTCCTACACCGTCTA
TGTACCAGACAGTGTTGGTTGGACGTACGAAGAAACCTTACTTGATCAGTAAGAAACACTTGAAGCACCCTCTGCTTAAC
GCTCTTGTAGAGAAGCAACAGAGATACGAAGAAGACGATAATGAAGATGGAAGTTGTATAATTACGGTGAAATGTGAGGT
TGTTTTGTTTGACCATCTTCTGTGGATGCTCGAATACGGTGACGAAGTTCACATATTAGAGTCTCTAGATGACTTTGCTC
ATCTCTATCTCTCCCCTTGA