Details for Arabidopsis Locus AT3G12940

Position : Chr3 ( 5`- 4130007 .. 4132467 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12940

Protein [Map View]
MMAGNGMPTLGRVKVCDLVPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPASDGALLRSGLDSARLYFHQRDSYPATNN
MIHTNDSQEWCKTSGYYADPQSWQESYEYRPGLTPTEPSNSMEFPPAGLPDIFALLGKAARVVLDAIGFYLNLRSCPFTE
ILDNVPLRNCEVSSSVLSVCCYARPSFHGAQHHSLTEDEQLILYSDHDHQLDKSLISFVKSDKAGLHIRDMHGQWILVDV
DLGPQEAVVYPGLALYQATAGYVSPAVHRTDLNSLQGSIEGRFSLAFKLMPKSMTNLSCSEMRAAGHGVEAQFQLPVSVD
DFMQRSHSNDELFNRQTLQSFIVPQSQDGSMKQLKKRRKSDSRCKPLPPSKRLRLEAQRVLKERVQEIADKKGIKLRFCN
LKECENNHNVMNSPCANIRREIGWPHGVPFVHPHDLPNKAKIGFLETYEPGWSETHDMEFSLSETAQGNQHVTN*

DNA
ATGATGGCAGGAAATGGAATGCCTACATTGGGTCGTGTCAAGGTTTGTGATTTAGTTCCCAGTGAAGGTCTACCTTCTGA
TTCTTACAAGTTAGCGGTGACTACATTGTCTCAATCTCTGGCACAGTACTCTGCAGCCATCATTCAGTTTCCTGCTAGCG
ATGGAGCCCTCCTTAGATCCGGTCTTGATTCTGCTCGGCTTTATTTTCACCAGAGAGATTCATATCCAGCCACTAATAAT
ATGATCCACACAAATGATTCACAAGAATGGTGCAAGACTTCTGGCTACTATGCAGATCCTCAGTCGTGGCAAGAGAGTTA
CGAGTATAGACCTGGTTTGACTCCGACCGAGCCAAGCAATTCTATGGAGTTCCCTCCTGCTGGTTTGCCTGATATCTTTG
CTTTACTAGGAAAAGCTGCTCGTGTAGTTCTTGATGCCATTGGTTTCTATTTGAACTTGAGAAGCTGTCCATTTACTGAG
ATTCTTGATAATGTCCCTTTGAGAAATTGTGAGGTATCGTCTTCTGTGTTATCTGTTTGCTGTTATGCTAGGCCATCCTT
TCATGGAGCACAGCACCATAGCTTAACAGAAGACGAGCAGCTTATCCTGTATTCAGACCATGATCACCAACTTGACAAGA
GTCTGATCTCATTTGTGAAATCAGATAAGGCGGGGTTGCACATCAGGGACATGCATGGGCAATGGATTTTAGTTGATGTG
GATCTTGGTCCTCAAGAGGCTGTTGTGTACCCGGGGCTAGCTCTTTACCAGGCTACAGCGGGGTATGTGAGTCCCGCAGT
GCACAGAACCGATTTGAACAGTCTGCAAGGAAGTATAGAAGGGAGGTTCTCCTTGGCCTTCAAACTCATGCCAAAATCAA
TGACCAATCTGAGTTGCTCGGAGATGAGAGCAGCAGGTCATGGTGTTGAAGCTCAGTTTCAGCTCCCCGTTTCTGTTGAT
GACTTCATGCAGAGATCTCACTCAAATGATGAACTTTTTAACAGACAGACTTTGCAAAGCTTCATCGTCCCTCAATCCCA
GGATGGATCAATGAAACAGCTGAAAAAACGGAGGAAGAGTGATTCTAGATGCAAACCACTACCACCTTCAAAACGGCTGA
GGTTAGAAGCACAGAGAGTTCTCAAGGAACGAGTTCAGGAGATTGCAGATAAAAAAGGAATCAAACTAAGATTCTGCAAT
CTCAAGGAGTGCGAGAATAACCACAATGTAATGAACAGCCCTTGTGCTAATATAAGAAGGGAGATCGGGTGGCCGCACGG
AGTTCCATTTGTTCATCCTCACGACCTACCCAATAAAGCGAAAATCGGTTTCCTTGAGACATATGAGCCTGGATGGTCTG
AAACACATGACATGGAGTTCAGTCTGTCTGAAACCGCTCAGGGAAACCAACATGTGACTAACTGA