Details for Arabidopsis Locus AT3G12920

Position : Chr3 ( 5`- 4121883 .. 4123508 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12920

Protein [Map View]
MAVEAHHLNPLFSSNREMIHPVEASGVVYNTQMRYGTVPTFNPTVECQTSLFNPIYNISPVDRLVHQSMKPTIQSVDSSL
TFNSDNNVDFLRPVSSRKRSREESVVLNPSAYMQIQKNPTDPLMFLGQDLSSNVQQHHFDIDRLISNHVERMRMEIEEKR
KTQGRRIVEAVEQGLMKTLRAKDDEINHIGKLNLFLEEKVKSLCVENQIWRDVAQSNEATVNALRSNLQQVLAAVERNRW
EEPPTVADDAQSCCGSNDEGDSEEERWKLAGEAQDTKKMCRVGMSMCRSCGKGEASVLLLPCRHMCLCSVCGSSLNTCPI
CKSPKTASLHVNLSS*

DNA
ATGGCCGTTGAAGCTCACCATCTAAATCCTCTGTTCTCTTCCAACAGAGAAATGATTCATCCCGTTGAAGCAAGCGGTGT
AGTCTATAACACCCAGATGAGATACGGCACCGTTCCGACGTTTAACCCCACCGTGGAATGTCAAACTTCTCTGTTTAACC
CAATCTACAACATCTCACCAGTCGATCGTTTGGTTCATCAATCCATGAAACCAACGATACAGTCCGTTGATAGTTCTCTC
ACATTCAACAGCGACAACAACGTCGATTTTCTTCGTCCTGTGTCGTCGAGAAAACGTTCTAGAGAAGAATCCGTTGTTCT
AAACCCTTCCGCTTATATGCAAATTCAGAAAAATCCCACCGATCCTCTTATGTTCCTTGGCCAAGACTTGTCTTCTAACG
TTCAACAACATCATTTCGATATCGATCGTTTGATCTCTAATCACGTTGAGAGAATGAGAATGGAGATTGAAGAGAAGAGA
AAAACACAAGGGAGAAGGATAGTGGAAGCCGTCGAACAAGGTTTGATGAAGACACTAAGAGCCAAAGACGATGAGATAAA
TCACATCGGGAAACTAAACCTCTTTCTCGAAGAGAAGGTTAAGTCTTTGTGCGTAGAGAATCAGATATGGCGTGACGTGG
CACAGTCTAATGAAGCCACCGTAAACGCCCTACGTTCTAACTTGCAACAAGTTCTCGCAGCCGTGGAGCGTAACCGGTGG
GAGGAGCCGCCCACGGTGGCTGACGACGCACAGTCTTGTTGCGGTAGCAACGACGAAGGTGATAGCGAGGAAGAACGGTG
GAAGTTAGCGGGAGAGGCGCAGGATACGAAAAAGATGTGTAGGGTAGGGATGAGTATGTGTAGAAGCTGTGGGAAAGGAG
AAGCAAGTGTGTTACTGTTACCGTGCAGACACATGTGTCTATGTTCTGTGTGTGGCTCTTCACTCAACACTTGTCCTATA
TGTAAATCTCCAAAGACCGCTAGTCTACATGTTAATCTTTCCTCTTAG