Details for Arabidopsis Locus AT3G12910

Position : Chr3 ( 5`- 4109375 .. 4110648 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12910

Protein [Map View]
MEKMIEPRDNTRESEDEDALKLPGFRFHPTDEELVGYYLSKKVLLKKTSKIDEIVSQIDIYKFDPWDLPRSRNTEKESYF
FCKRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSDGSNKAVIGLKKTLVYYLGSAGKGNKTDWMMHEFRLPTANDTIPGG
PTHSNPTPTSLLHAEVWTLCRIFKRTVSSRKYTPDWRELANGKRVKQQQSNYQEAYINFGDNESSSSTNVMNVREGKGNY
ERSVFQLQQTPYQHQNQPILMDTTHVDSFQHFSNDNIHHETYETWPDELRSVVEFAFPPSFLS*

DNA
ATGGAGAAGATGATAGAACCACGGGACAACACAAGAGAATCAGAAGATGAGGATGCGTTAAAGCTTCCAGGGTTTAGGTT
TCATCCGACGGATGAGGAGCTTGTAGGGTATTATCTCTCTAAAAAAGTGCTTCTCAAAAAAACGAGCAAGATTGATGAGA
TCGTCAGCCAAATTGATATCTATAAATTTGATCCGTGGGATCTTCCAAGGTCGAGGAATACAGAGAAGGAGAGCTACTTC
TTTTGTAAGAGAGGAAGGAAATACAGAAACAGCATAAGACCGAACCGAGTGACTGGTTCCGGTTTCTGGAAAGCCACAGG
GATAGACAAGCCTGTCTATTCCGATGGATCCAACAAAGCCGTGATCGGTCTAAAGAAGACACTCGTTTATTACCTAGGAA
GCGCCGGGAAAGGAAACAAGACGGATTGGATGATGCACGAGTTTCGTCTCCCTACAGCCAATGACACAATCCCCGGTGGC
CCTACACACTCTAACCCTACTCCAACTTCCTTGCTACACGCGGAAGTATGGACGTTATGCCGGATATTTAAGAGAACTGT
GTCTAGTCGAAAATACACTCCGGACTGGAGAGAATTAGCAAATGGCAAACGTGTGAAGCAGCAACAATCTAATTACCAAG
AAGCTTATATAAATTTTGGGGACAATGAAAGTAGTAGTAGTACCAACGTGATGAACGTTAGGGAAGGCAAAGGGAACTAC
GAGAGAAGCGTTTTCCAGCTTCAGCAAACGCCTTATCAACATCAAAACCAGCCAATTCTCATGGACACCACACACGTTGA
TTCGTTTCAACATTTCTCCAACGATAACATTCACCATGAAACCTACGAGACTTGGCCGGACGAGCTTCGATCGGTTGTGG
AATTTGCTTTCCCACCTTCTTTTCTTAGTTAG