Details for Arabidopsis Locus AT3G12900

Position : Chr3 ( 5`- 4104576 .. 4106112 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12900

Protein [Map View]
MGINFEDQTTLFNFVVREGNGVKGMIDSGLSSVPRPFVQPLSERIPTQKALTCEATQPIDLSNLDGPQHKEVAKQIVEAA
ETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKSMYLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEAL
QHWPQPCREVALEFLNSSMEMVKNVVNILMENVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTVGVGRHSDMGMLTVL
LQDGIGGLYVKLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTAPNPSQKVGPLPEVV
KRDGVARYKEFLFQDYMNNFFGQPHDGKKSLDFARAE*

DNA
ATGGGTATCAATTTCGAGGACCAAACCACATTGTTCAATTTCGTGGTCAGAGAAGGTAACGGCGTGAAAGGAATGATAGA
CTCGGGCCTCTCTAGTGTTCCACGGCCCTTCGTCCAGCCTCTCTCTGAGCGAATCCCGACCCAAAAAGCCCTTACGTGTG
AGGCTACCCAGCCAATCGATCTTTCCAACCTAGACGGCCCACAACACAAGGAGGTGGCCAAGCAGATTGTCGAAGCTGCC
GAGACACTTGGCTTCTTCCAGGTGGTGAACCATGGTGTTTCGGTGGAGCTGCTGGAGTTGCTAAAATCGTCGGCTCATGA
GTTTTTTGCACAAGCTCCTGAGGAAAAATCGATGTACCTGAAGGAAGTGAGTCCAAGCAAGCTGGTTAAGTACGGAACGA
GCTTTGTGCCAGATAAGGAGAAGGCGATTGAGTGGAAGGATTATGTGAGCATGCTTTACACCAATGACAGTGAGGCTCTT
CAACACTGGCCTCAACCATGCAGGGAGGTGGCACTTGAGTTCCTAAATTCATCGATGGAAATGGTGAAAAATGTAGTTAA
CATTCTGATGGAGAATGTTGGAGTGACACTAGAAGAAGAGAAAATGAATGGTTTGATGGGAACCAAGATGGTCAACATGA
ACTACTACCCTACTTGTCCGAGCCCCGAGCTGACCGTCGGCGTCGGCCGTCACTCAGACATGGGAATGTTGACCGTTTTA
TTACAAGACGGCATTGGTGGTCTCTACGTTAAACTAGACAACGGTGAATGGGCCGAGATCCCTCCTGTCCATGGAGCTTT
GGTCATCAACATCGGCGACACTTTGCAGATTTTGAGCAATGGGAAGTACAAAAGTGCGGAGCATAGGGTTCGAACCACAA
ACATCGGATCAAGAGTCTCTGTGCCCATTTTCACGGCACCAAATCCCTCCCAGAAGGTCGGTCCCTTGCCGGAAGTTGTG
AAACGCGACGGAGTGGCTCGTTACAAGGAGTTTTTGTTTCAAGACTACATGAATAACTTCTTCGGCCAACCACACGACGG
CAAAAAATCTCTCGACTTCGCACGTGCCGAGTGA