Details for Arabidopsis Locus AT3G12890

Position : Chr3 ( 5`- 4099199 .. 4100473 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12890

Protein [Map View]
MASSLPQFYADFTTFSCETSSQFHGSSSCPDVDSSLSSYLDDCYGSFNTSSNPESIFVPQVFGISDVSVPEYNNYYQKMS
VNNATHYFHGGDHQEYYGFSPEIKPLFRPATGEQSWGNSEGGIQAEPNTKVGRYSVEERKDRIMRYLKKKNQRNFNKTIK
YVCRKTLADRRVRVRGRFARNNDTCEEQPHMSKNHNNHSEKEEDMFSGSDDYLIQMEHDDGWLHEAMSNLIPFPCEFDAP
GDAHHPTNWSF*

DNA
ATGGCATCATCTCTTCCTCAGTTCTACGCTGATTTCACAACATTTTCCTGCGAGACTTCTTCGCAGTTTCACGGCTCTTC
TTCATGTCCTGACGTGGACTCTTCGTTATCCAGCTACCTCGACGACTGTTATGGCTCCTTCAACACCTCTTCTAATCCAG
AATCCATCTTTGTACCCCAAGTCTTTGGGATTTCTGACGTCTCTGTGCCTGAATACAACAATTATTACCAGAAAATGAGT
GTGAATAATGCCACACATTACTTTCATGGTGGAGATCATCAAGAATACTACGGCTTTTCACCGGAGATCAAGCCCTTGTT
CCGTCCGGCCACAGGAGAGCAATCTTGGGGAAATAGTGAAGGAGGGATACAAGCTGAGCCAAATACAAAAGTGGGACGCT
ATTCGGTGGAGGAACGTAAAGACAGAATCATGAGGTACTTGAAGAAGAAGAACCAACGCAACTTCAATAAGACCATCAAG
TATGTGTGTCGTAAAACCCTAGCCGACAGGCGTGTTCGTGTTCGCGGCCGATTTGCTAGAAACAATGACACATGTGAAGA
ACAACCTCACATGTCTAAGAATCACAACAACCATTCTGAAAAAGAGGAAGATATGTTTTCAGGATCAGACGACTATCTAA
TCCAGATGGAACACGATGACGGATGGCTTCACGAAGCAATGTCCAATCTGATTCCTTTTCCTTGTGAATTTGACGCTCCT
GGAGATGCTCATCATCCAACCAATTGGAGCTTCTGA