Details for Arabidopsis Locus AT3G12880

Position : Chr3 ( 5`- 4095535 .. 4096236 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12880

Protein [Map View]
MNKKMALLAKLLILTTLVTTISVISRANEELMMQQCHNSDNPTLCLRCLSSDPGSHEADKVGLARIILKCINSHLLVLTK
NASTLGSQHYQNPNTAAALKQCGLGFSTAKHGVGEADTQLITGDYDKAAYDVSVKVVNPPVSCRNSLEALNIQVPSSFRY
HMDVYLALTQALLRIVDRF*

DNA
ATGAACAAAAAAATGGCTTTGCTTGCAAAACTTCTTATCCTCACCACACTTGTAACAACAATATCAGTAATATCCAGAGC
CAATGAAGAGCTAATGATGCAACAATGTCACAACTCTGACAATCCCACCTTGTGTCTTCGCTGTCTAAGCTCCGACCCTG
GTTCTCATGAGGCCGACAAAGTAGGACTGGCTCGTATCATCCTCAAATGCATCAACTCACACCTCCTTGTTCTCACCAAG
AACGCTTCCACTTTGGGCTCGCAGCACTACCAGAATCCAAATACTGCAGCAGCGTTGAAGCAGTGCGGTTTGGGTTTCTC
AACGGCTAAGCATGGCGTGGGAGAGGCCGACACTCAACTTATAACCGGAGATTACGACAAGGCTGCGTATGACGTCAGCG
TGAAGGTGGTGAATCCTCCGGTATCGTGCCGCAACAGTCTCGAGGCACTCAACATTCAAGTCCCTTCAAGTTTCCGTTAC
CATATGGATGTATACTTGGCGTTGACTCAAGCTCTCCTCAGGATCGTTGATCGCTTCTAG