Details for Arabidopsis Locus AT3G12870

Position : Chr3 ( 5`- 4094417 .. 4095037 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12870

Protein [Map View]
MASDQSTNPPIMEAKTRHPLHQIADTPTHKLLLKQWLKEEELILSRVSHKESQIDSVRREITQLYIFFFLFHSISLLLLF
HASSSSSSSASSSACKRSWIPSLCALLSSLGIIWAVRYKSEVESHLEKLLEREKEDAKLLRKCVEELKKKGIEFDLLKEV
DALRRAKSLRVESKPVKKWSARDFVTLFFFSVSCLVLAMIRLILCD*

DNA
ATGGCGTCAGATCAGAGCACGAATCCACCGATCATGGAGGCAAAGACAAGACATCCTCTTCACCAGATCGCAGATACACC
AACACACAAGCTTCTCCTGAAACAATGGTTAAAAGAAGAAGAGCTAATTCTAAGCCGTGTCTCTCACAAAGAATCTCAGA
TCGATTCTGTTCGAAGAGAAATCACTCAGCTCTACATCTTCTTCTTTCTCTTCCACTCCATTTCTCTGCTACTTCTCTTC
CACGCTTCTTCATCCTCATCTTCCTCTGCTTCTTCCAGTGCTTGTAAAAGATCATGGATCCCTTCACTCTGCGCTCTGCT
ATCTTCCTTGGGGATCATTTGGGCGGTACGGTACAAATCTGAAGTGGAATCGCATCTTGAGAAGTTGTTGGAGAGGGAGA
AAGAAGATGCGAAGCTGTTGCGTAAATGTGTTGAAGAGTTGAAGAAGAAAGGTATCGAATTTGATTTGCTTAAGGAAGTG
GATGCGCTTCGTAGAGCCAAGAGTTTAAGAGTTGAGTCGAAGCCTGTGAAGAAATGGTCTGCTAGGGATTTTGTGACGCT
CTTCTTCTTCTCTGTTTCGTGTTTGGTTCTTGCCATGATTAGACTCATTCTCTGCGATTGA