Details for Arabidopsis Locus AT3G12860

Position : Chr3 ( 5`- 4091570 .. 4093921 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12860

Protein [Map View]
MKIYLLSESPSGYGLFEGHGSDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFQSALDALNQINAVSEGYMSDELRSFLE
LNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEFVHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKV
KFNVNRVDNMVIQAIFMLDTLDKDINSFAMRVREWYSWHFPELVKIVNDNYLYAKVSKIIVDKSKLSEEHIPMLTEALGD
EDKAREVIEAGKASMGQDLSPVDLINVQTFAQRVMDLADYRKKLYDYLVTKMSDIAPNLAALIGEMVGARLISHAGSLTN
LAKCPSSTLQILGAEKALFRALKTRGNTPKYGLIFHSSFIGRASAKNKGRIARFLANKCSIASRIDCFSDNSTTAFGEKL
REQVEERLDFYDKGVAPRKNVDVMKEVLENLEKKDEGEKTVDASEKKKKRKTEEKEEEKEEEKSKKKKKKSKAVEGEELT
ATDNGHSKKKKKTKSQDDE*

DNA
ATGAAGATTTATCTTCTTTCCGAATCACCCTCCGGCTACGGATTGTTCGAGGGACACGGTTCCGATGAGATTGGACAGAA
CACGGAGGCGGTTCGGAGCTCCGTCTCGGACCTTAGTCGGTTCGGGCGGGTCGTCCAGCTCACTGCTTTTCACCCGTTCC
AGTCTGCACTCGATGCTCTTAACCAAATCAACGCCGTCTCTGAAGGATACATGAGCGATGAGCTGAGAAGTTTTCTGGAG
CTGAATCTCCCGAAAGTGAAGGAAGGCAAGAAGCCCAAGTTTAGTTTGGGAGTGTCTGAGCCTAAAATCGGTTCTTGCAT
TTTTGAAGCTACCAAAATTCCTTGCCAGAGCAATGAGTTTGTCCATGAGCTCCTTAGAGGTGTGCGTCAGCATTTCGATA
GGTTCATCAAAGACTTGAAGCCTGGTGATTTGGAAAAAGCTCAACTTGGACTAGCTCATAGCTACAGCAGAGCAAAGGTG
AAGTTCAATGTTAACCGGGTGGATAACATGGTTATTCAAGCTATTTTCATGCTTGACACACTTGATAAGGATATCAATTC
CTTTGCTATGAGAGTCAGAGAATGGTACTCATGGCACTTCCCTGAGCTTGTCAAGATAGTTAATGACAACTACCTCTACG
CCAAAGTTTCAAAGATTATCGTCGACAAGTCAAAGTTGTCTGAAGAGCACATCCCTATGCTTACTGAAGCCCTGGGTGAT
GAAGATAAGGCAAGAGAGGTTATTGAAGCTGGAAAAGCATCTATGGGCCAGGATTTATCACCGGTTGATCTGATCAATGT
CCAGACCTTTGCTCAGAGAGTTATGGACCTTGCAGATTACAGGAAGAAGCTCTATGATTATCTTGTTACTAAAATGAGTG
ACATTGCTCCAAATTTGGCGGCCTTGATCGGAGAGATGGTTGGGGCTAGGTTGATTTCACATGCAGGAAGTCTGACAAAT
CTTGCCAAGTGCCCATCTTCAACCCTCCAGATTCTCGGTGCTGAGAAGGCACTTTTCAGGGCACTGAAAACACGTGGAAA
CACACCCAAATATGGTCTAATATTCCATTCATCATTCATCGGGCGTGCATCTGCTAAAAACAAGGGCCGTATTGCTCGTT
TCCTTGCAAACAAGTGTTCCATTGCTTCCCGGATTGATTGTTTCTCAGATAACAGCACTACAGCTTTCGGTGAGAAACTA
AGGGAACAAGTAGAGGAAAGACTTGACTTTTATGACAAAGGTGTTGCCCCACGTAAGAATGTTGATGTAATGAAAGAAGT
GTTGGAAAATCTTGAGAAGAAAGACGAGGGAGAAAAAACAGTGGATGCTTCGGAGAAGAAAAAGAAGAGAAAGACAGAGG
AGAAGGAGGAGGAGAAGGAAGAGGAGAAATCAAAGAAAAAGAAAAAGAAAAGCAAAGCAGTAGAAGGAGAGGAATTGACA
GCAACAGATAATGGCCATAGCAAGAAGAAGAAGAAAACTAAGTCACAAGATGATGAATAA