Details for Arabidopsis Locus AT3G12830

Position : Chr3 ( 5`- 4078651 .. 4079608 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12830

Protein [Map View]
MKQLIRRLSRVADSAQYSLLRSDSQRPSRRSESFLRSSVTRRSKKQTSSVPEGHVPVYVGDEMERFVVSAELLNHPVFIG
LLNRSAQEYGYEQKGVLQIPCHVLVFERIMESLRLGLPVPIDVQDLIGDGTI*

DNA
ATGAAGCAACTAATCCGTCGTCTCTCTCGCGTCGCTGATTCCGCTCAATACAGTCTCCTCCGTTCCGATTCACAGCGACC
TAGCCGCCGTTCCGAATCCTTCCTCCGTTCTTCGGTGACTCGCCGCTCAAAGAAGCAAACCTCCTCTGTTCCCGAAGGAC
ACGTACCGGTCTACGTAGGTGACGAGATGGAGAGGTTCGTCGTTAGCGCGGAGCTACTTAACCATCCGGTTTTCATCGGT
TTACTAAACCGATCTGCTCAAGAGTATGGTTACGAGCAAAAAGGAGTTCTACAAATCCCTTGCCATGTCCTTGTCTTCGA
ACGAATCATGGAATCGCTTCGTCTTGGACTTCCGGTACCGATTGATGTTCAGGATCTAATCGGTGACGGGACTATTTGA