Details for Arabidopsis Locus AT3G12820

Position : Chr3 ( 5`- 4074158 .. 4075614 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12820

Protein [Map View]
MGNRRAPCCDKSQVKRGPWSDEESERLRSFILKNGHQNWRSLPKLAGLMRCGKSCRLRWINYLRPGLKRGNFTKEEEDTI
IHLHQAYGNKWSKIASNFPGRTDNEIKNVWNTHLKKRLVKRSISSSSSDVTNHSVSSTSSSSSSISSVLQDVIIKSERPN
QEEEFGEILVEQMACGFEVDAPQSLECLFDDSQVPPPISKPDSLQTHGKSSDHEFWSRLIEPGFDDYNEWLIFLDNQTC*

DNA
ATGGGGAATAGAAGAGCACCATGCTGTGACAAAAGCCAAGTGAAGAGAGGGCCATGGAGTGATGAAGAAAGTGAAAGACT
CAGATCTTTTATCCTCAAAAATGGTCATCAAAATTGGCGATCTCTTCCCAAACTCGCTGGATTGATGAGATGCGGAAAGA
GTTGTCGTCTAAGATGGATAAACTATCTGAGACCAGGTCTCAAACGAGGCAACTTCACCAAGGAGGAGGAAGATACCATT
ATCCACCTTCACCAAGCTTATGGAAACAAGTGGTCTAAGATCGCATCCAACTTCCCGGGAAGGACAGACAACGAGATCAA
GAATGTATGGAACACTCATCTCAAGAAGCGGTTGGTGAAGAGGAGCATTTCATCATCATCATCCGATGTTACCAATCATT
CAGTGTCTTCTACCTCTTCTTCCTCTTCCTCAATCTCGTCAGTCTTGCAGGACGTTATTATTAAGAGTGAGAGGCCTAAC
CAGGAAGAGGAGTTTGGGGAAATCTTGGTGGAGCAAATGGCATGTGGATTTGAGGTGGATGCACCACAATCACTAGAATG
TCTCTTTGACGATAGCCAGGTTCCTCCTCCTATATCTAAACCAGACTCACTACAAACCCATGGGAAGTCATCAGATCACG
AATTTTGGAGCCGACTGATTGAACCAGGGTTCGATGATTACAATGAGTGGCTCATTTTCTTGGATAACCAAACTTGCTAG