Details for Arabidopsis Locus AT3G12810

Position : Chr3 ( 5`- 4065042 .. 4074078 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12810

Protein [Map View]
MASKGGKSKPDIVMASKSGKSKPDNESRAKRQKTLEAPKEPRRPKTHWDHVLEEMAWLSKDFESERKWKLAQAKKVALRA
SKGMLDQASREERKLKEEEQRLRKVALNISKDMKKFWMKVEKLVLYKHQLVRNEKKKKAMDKQLEFLLGQTERYSTMLAE
NLVEPYKQGQNTPSKPLLTIESKSDEERAEQIPPEINSSAGLESGSPELDEDYDLKSEDETEDDEDTIEEDEKHFTKRER
QEELEALQNEVDLPVEELLRRYTSGRVSRETSPVKDENEDNLTSVSRVTSPVKDENQDNLASVGQDHGEDKNNLAASEET
EGNPSVRRSNDSYGHLAISETHSHDLEPGMTTASVKSRKEDHTYDFNDEQEDVDFVLANGEEKDDEATLAVEEELAKADN
EDHVEEIALLQKESEMPIEVLLARYKEDFGGKDISEDESESSFAVSEDSIVDSDENRQQADLDDDNVDLTECKLDPEPCS
ENVEGTFHEVAEDNDKDSSDKIADAAAAARSAQPTGFTYSTTKVRTKLPFLLKHSLREYQHIGLDWLVTMYEKKLNGILA
DEMGLGKTIMTIALLAHLACDKGIWGPHLIVVPTSVMLNWETEFLKWCPAFKILTYFGSAKERKLKRQGWMKLNSFHVCI
TTYRLVIQDSKMFKRKKWKYLILDEAHLIKNWKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHVFQSHQE
FKDWFCNPIAGMVEGQEKINKEVIDRLHNVLRPFLLRRLKRDVEKQLPSKHEHVIFCRLSKRQRNLYEDFIASTETQATL
TSGSFFGMISIIMQLRKVCNHPDLFEGRPIVSSFDMAGIDVQLSSTICSLLLESPFSKVDLEALGFLFTHLDFSMTSWEG
DEIKAISTPSELIKQRVNLKDDLEAIPLSPKNRKNLQGTNIFEEIRKAVFEERIQESKDRAAAIAWWNSLRCQRKPTYST
SLRTLLTIKGPLDDLKANCSSYMYSSILADIVLSPIERFQKMIELVEAFTFAIPAARVPSPTCWCSKSDSPVFLSPSYKE
KVTDLLSPLLSPIRPAIVRRQVYFPDRRLIQFDCGKLQELAMLLRKLKFGGHRALIFTQMTKMLDVLEAFINLYGYTYMR
LDGSTPPEERQTLMQRFNTNPKIFLFILSTRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQTREVHIYRLIS
ESTIEENILKKANQKRVLDNLVIQNGEYNTEFFKKLDPMELFSGHKALTTKDEKETSKHCGADIPLSNADVEAALKQAED
EADYMALKRVEQEEAVDNQEFTEEPVERPEDDELVNEDDIKADEPADQGLVAAGPAKEEMSLLHSDIRDERAVITTSSQE
DDTDVLDDVKQMAAAAADAGQAISSFENQLRPIDRYAIRFLELWDPIIVEAAMENEAGFEEKEWELDHIEKYKEEMEAEI
DDGEEPLVYEKWDADFATEAYRQQVEVLAQHQLMEDLENEAREREAAEVAEMVLTQNESAHVLKPKKKKKAKKAKYKSLK
KGSLAAESKHVKSVVKIEDSTDDDNEEFGYVSSSDSDMVTPLSRMHMKGKKRDLIVDTDEEKTSKKKAKKHKKSLPNSDI
KYKQTSALLDELEPSKPSDSMVVDNELKLTNRGKTVGKKFITSMPIKRVLMIKPEKLKKGNLWSRDCVPSPDSWLPQEDA
ILCAMVHEYGPNWNFVSGTLYGMTAGGAYRGRYRHPAYCCERYRELIQRHILSASDSAVNEKNLNTGSGKALLKVTEENI
RTLLNVAAEQPDTEMLLQKHFSCLLSSIWRTSTRTGNDQMLSLNSPIFNRQFMGSVNHTQDLARKPWQGMKVTSLSRKLL
ESALQDSGPSQPDNTISRSRLQETQPINKLGLELTLEFPRGNDDSLNQFPPMISLSIDGSDSLNYVNEPPGEDVLKGSRV
AAENRYRNAANACIEDSFGWASNTFPANDLKSRTGTKAQSLGKHKLSASDSAKSTKSKHRKLLAEQLEGAWVRPNDPNLK
FDFTPGDREEEEEQEVDEKANSAEIEMISCSQWYDPFFTSGLDDCSLASDISEIE*

DNA
ATGGCGTCTAAAGGTGGTAAATCTAAACCTGATATAGTAATGGCGTCCAAGAGTGGGAAATCTAAACCTGATAATGAATC
CAGAGCTAAGCGTCAGAAGACGCTCGAAGCTCCTAAAGAACCACGTCGTCCTAAAACTCACTGGGACCATGTATTGGAGG
AGATGGCTTGGCTGTCAAAGGACTTTGAGTCTGAGAGGAAATGGAAGCTGGCGCAGGCGAAGAAGGTTGCTTTGAGAGCC
AGCAAAGGAATGCTAGATCAGGCATCTAGGGAAGAAAGGAAGCTAAAGGAAGAAGAACAGCGACTTCGGAAAGTAGCCCT
CAATATCTCGAAAGACATGAAAAAGTTTTGGATGAAAGTTGAGAAGCTGGTGCTTTACAAGCATCAGTTGGTACGCAATG
AGAAGAAGAAGAAGGCTATGGACAAGCAACTTGAATTTCTGTTAGGCCAAACTGAGAGGTACTCAACCATGTTGGCAGAA
AATTTAGTGGAGCCTTATAAACAGGGCCAAAATACTCCTTCAAAACCTCTACTAACTATCGAATCAAAAAGTGATGAGGA
GAGGGCAGAACAGATACCTCCAGAGATAAATTCTTCTGCAGGTCTTGAATCAGGAAGTCCTGAACTCGATGAGGATTATG
ATCTAAAATCTGAGGATGAGACCGAAGATGATGAAGATACTATTGAGGAGGATGAAAAACACTTCACCAAACGTGAAAGA
CAGGAAGAGTTGGAAGCTTTGCAAAATGAAGTGGATCTACCAGTTGAGGAGCTGCTCAGACGTTATACCTCTGGAAGAGT
TAGCCGAGAAACCAGCCCAGTAAAAGATGAAAATGAGGACAATCTGACCTCAGTTAGCCGAGTAACCAGCCCAGTAAAAG
ATGAAAATCAGGACAATCTGGCCTCAGTAGGTCAAGATCATGGAGAGGACAAGAACAATCTTGCAGCTTCTGAAGAAACT
GAAGGGAACCCAAGTGTTCGTCGTTCTAATGATAGCTATGGTCATTTGGCAATATCCGAGACCCATTCACATGACCTTGA
GCCAGGCATGACGACTGCATCTGTGAAGTCCAGAAAGGAAGATCATACCTATGATTTTAACGATGAACAGGAAGATGTTG
ACTTTGTTCTTGCCAATGGTGAGGAAAAGGATGATGAGGCGACATTGGCTGTCGAAGAGGAACTGGCGAAAGCAGATAAT
GAAGATCATGTCGAAGAGATTGCCCTGCTGCAAAAAGAGAGTGAAATGCCTATTGAAGTACTACTTGCAAGGTATAAGGA
GGATTTCGGTGGCAAGGATATATCTGAGGATGAATCTGAATCTTCATTTGCTGTATCTGAAGACTCTATAGTAGACTCTG
ACGAAAATAGGCAGCAAGCTGATTTAGATGATGACAACGTTGATTTAACAGAATGTAAGCTAGATCCAGAGCCTTGCTCA
GAAAATGTTGAAGGCACATTCCATGAAGTAGCAGAAGATAATGATAAAGATAGTAGTGATAAAATTGCTGATGCAGCAGC
AGCAGCAAGATCTGCCCAGCCAACTGGATTTACATACTCCACAACAAAAGTTCGAACGAAACTGCCGTTTCTACTTAAGC
ATTCTCTGCGTGAGTACCAACACATTGGTTTGGACTGGCTTGTCACGATGTATGAGAAAAAGTTGAACGGTATTCTGGCT
GATGAAATGGGTCTTGGAAAGACAATTATGACCATTGCTCTTCTAGCTCACCTTGCATGTGATAAGGGAATATGGGGTCC
CCATCTGATTGTGGTTCCTACAAGTGTGATGCTTAATTGGGAGACTGAGTTTCTTAAATGGTGTCCTGCATTTAAAATTC
TCACCTACTTTGGTAGTGCAAAGGAGCGGAAACTCAAGAGACAAGGATGGATGAAGCTTAACTCATTTCATGTATGCATA
ACAACCTATAGGCTAGTTATTCAGGACAGTAAAATGTTCAAGCGCAAGAAGTGGAAATACTTGATTCTTGACGAAGCCCA
TTTAATTAAGAATTGGAAGTCTCAGAGATGGCAGACACTATTGAACTTCAATTCTAAACGCAGAATTTTGTTGACTGGTA
CACCCCTGCAGAATGATCTTATGGAACTGTGGTCACTTATGCACTTTCTGATGCCACATGTCTTTCAGTCTCACCAGGAA
TTCAAAGACTGGTTCTGTAACCCAATAGCAGGGATGGTCGAGGGACAAGAAAAAATCAACAAAGAAGTTATTGATCGCTT
ACATAATGTCCTCCGTCCTTTCCTTCTACGGCGCCTAAAAAGGGATGTGGAGAAGCAACTTCCTTCGAAACATGAGCATG
TTATTTTCTGTAGACTGTCTAAGAGGCAGCGCAACTTGTATGAGGACTTCATAGCAAGCACAGAAACACAGGCTACGCTT
ACCAGTGGAAGCTTTTTTGGGATGATAAGTATCATAATGCAGTTGCGGAAAGTTTGTAATCATCCTGATCTCTTTGAGGG
TCGTCCTATTGTAAGTTCTTTTGATATGGCTGGCATTGATGTGCAGTTGAGTTCAACAATCTGTTCGCTACTATTGGAAA
GTCCGTTTTCCAAGGTTGATCTTGAGGCTTTGGGATTCTTATTCACCCATCTTGATTTTTCTATGACTTCTTGGGAAGGA
GATGAGATCAAAGCTATTTCAACACCCTCAGAATTAATCAAACAGCGTGTGAACTTGAAGGATGATCTAGAAGCAATCCC
TTTGAGTCCAAAAAACCGCAAAAATCTGCAAGGGACAAATATTTTTGAAGAAATTCGTAAGGCTGTCTTTGAGGAAAGGA
TACAAGAATCTAAGGATCGGGCAGCAGCCATTGCATGGTGGAATTCTTTGAGATGCCAGAGAAAGCCGACTTACTCTACA
TCACTAAGAACTCTTTTAACCATTAAGGGTCCTCTTGATGATCTTAAAGCTAACTGTTCATCTTACATGTATTCATCAAT
CCTCGCTGACATAGTCCTTTCACCAATCGAGCGTTTTCAGAAGATGATTGAGCTAGTTGAAGCTTTCACATTTGCGATTC
CAGCTGCACGAGTGCCTTCACCTACTTGCTGGTGCAGTAAAAGTGACTCTCCTGTTTTTCTTAGTCCATCGTACAAGGAA
AAAGTTACAGATTTATTGTCACCTCTTTTATCTCCAATTAGACCTGCAATCGTTAGGAGACAAGTATATTTTCCAGATAG
GCGACTGATACAGTTTGATTGTGGTAAGCTGCAGGAGCTTGCTATGTTATTGAGGAAATTAAAATTTGGGGGTCACAGAG
CGTTGATATTCACGCAAATGACCAAGATGCTTGACGTCTTGGAGGCTTTCATTAATTTATATGGTTATACCTACATGCGT
CTTGATGGCTCTACACCTCCAGAAGAGAGGCAGACGTTAATGCAGCGGTTTAATACAAATCCCAAGATCTTTCTTTTCAT
TTTGTCAACCCGAAGTGGGGGCGTTGGCATCAACCTTGTGGGTGCGGACACAGTTATATTCTATGACAGTGACTGGAATC
CTGCTATGGATCAACAAGCTCAAGATCGCTGCCACAGGATAGGTCAGACACGTGAAGTGCATATATACCGGTTGATAAGT
GAGAGCACCATTGAGGAGAATATCTTAAAGAAAGCAAACCAGAAGCGTGTGCTTGATAACCTAGTAATTCAAAACGGTGA
GTATAACACCGAATTTTTCAAGAAGCTCGATCCCATGGAATTGTTCTCTGGGCATAAGGCTCTGACTACAAAGGATGAAA
AGGAAACAAGCAAGCATTGTGGGGCGGATATACCTCTATCAAATGCAGATGTTGAGGCTGCTCTAAAACAGGCCGAAGAT
GAGGCAGATTATATGGCTCTCAAAAGAGTAGAACAAGAAGAAGCTGTGGACAATCAAGAGTTCACAGAAGAACCTGTAGA
GAGACCAGAAGACGATGAGCTAGTAAATGAAGATGACATAAAGGCTGATGAGCCTGCTGATCAAGGTTTAGTTGCAGCAG
GGCCGGCCAAAGAAGAAATGTCATTGTTACATAGTGATATCAGGGATGAGAGAGCTGTTATCACTACTTCAAGCCAAGAA
GATGACACTGATGTATTAGATGATGTCAAGCAAATGGCTGCAGCAGCGGCTGATGCTGGACAAGCTATCTCATCTTTTGA
GAATCAGCTACGTCCTATTGATAGATATGCGATTAGATTTTTAGAGCTTTGGGACCCCATCATTGTTGAGGCTGCAATGG
AAAATGAAGCAGGATTTGAAGAGAAAGAATGGGAACTTGACCACATTGAGAAGTACAAGGAGGAAATGGAAGCTGAGATT
GATGATGGGGAAGAGCCTCTTGTTTACGAGAAATGGGATGCTGATTTTGCAACTGAGGCATACAGGCAGCAAGTGGAAGT
CTTAGCTCAGCACCAGTTAATGGAAGATTTGGAAAATGAAGCTAGAGAGAGGGAAGCGGCAGAGGTGGCTGAAATGGTTT
TGACACAGAACGAAAGTGCTCATGTACTGAAGCCTAAGAAGAAGAAAAAGGCGAAGAAAGCCAAATATAAATCCCTGAAG
AAAGGATCACTGGCTGCCGAATCAAAACATGTGAAGTCAGTTGTGAAAATTGAAGATTCTACTGATGATGATAATGAAGA
ATTCGGCTATGTGAGTAGCAGTGACTCGGATATGGTTACACCGCTTTCGCGGATGCATATGAAGGGCAAGAAAAGAGATT
TAATTGTTGACACTGATGAAGAGAAGACCTCAAAGAAGAAAGCAAAGAAGCACAAGAAGTCTCTCCCGAATTCAGATATC
AAATATAAGCAAACAAGTGCACTACTTGATGAACTGGAACCATCAAAGCCGTCTGACAGTATGGTTGTTGATAATGAGTT
GAAATTGACGAACAGGGGTAAAACTGTAGGGAAAAAATTCATCACTTCCATGCCAATAAAGCGTGTTCTTATGATCAAGC
CAGAGAAATTGAAGAAAGGAAATCTGTGGTCTAGAGATTGTGTTCCCTCGCCTGATTCTTGGTTGCCGCAGGAAGATGCT
ATATTGTGTGCCATGGTTCATGAATATGGGCCTAACTGGAATTTTGTTAGCGGAACTCTTTATGGAATGACAGCTGGTGG
GGCTTACAGAGGACGGTATCGGCATCCTGCATATTGTTGTGAGAGATATAGAGAGCTTATTCAACGACATATTTTGTCTG
CTTCCGACAGTGCAGTGAACGAGAAGAACCTCAACACAGGTTCTGGGAAGGCTCTCCTTAAAGTCACTGAGGAAAATATT
CGGACACTCCTAAATGTTGCAGCTGAGCAGCCAGATACGGAGATGCTCCTACAAAAACATTTTTCTTGCTTGCTGTCATC
AATTTGGAGGACGTCTACCCGCACTGGGAATGATCAAATGCTCTCCTTAAACAGTCCTATTTTCAACAGACAGTTTATGG
GTTCCGTGAATCACACCCAAGATTTAGCTAGAAAGCCTTGGCAGGGGATGAAGGTCACCAGCTTAAGTAGAAAGTTGTTA
GAATCCGCTCTCCAGGATTCTGGCCCGAGTCAGCCAGACAATACTATTTCCCGTTCTAGGTTGCAGGAGACTCAACCTAT
CAATAAATTGGGATTAGAGTTAACCTTGGAATTCCCACGTGGCAATGATGATTCCCTGAATCAGTTTCCACCGATGATTA
GTCTGTCCATTGATGGGTCAGATTCATTAAATTATGTGAACGAGCCCCCAGGGGAAGATGTTCTAAAAGGTTCTAGGGTT
GCTGCAGAGAACCGTTACAGGAATGCTGCAAATGCTTGTATTGAAGATTCATTTGGATGGGCTTCAAACACGTTCCCAGC
CAATGATCTGAAGTCAAGAACAGGCACGAAAGCACAGTCCCTGGGGAAACACAAGCTATCCGCCTCAGACTCAGCCAAGT
CTACAAAAAGCAAACACCGCAAACTCTTAGCAGAGCAATTGGAAGGGGCATGGGTTAGGCCAAATGATCCGAATCTCAAG
TTTGATTTCACACCTGGTGATAGGGAGGAGGAGGAGGAGCAGGAGGTGGATGAGAAAGCGAATTCAGCAGAGATAGAGAT
GATAAGCTGTTCACAATGGTATGATCCATTCTTTACCTCAGGCCTTGATGATTGCTCATTAGCTTCGGATATCTCAGAAA
TAGAGTAG