Details for Arabidopsis Locus AT3G12800

Position : Chr3 ( 5`- 4063323 .. 4064822 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12800

Protein [Map View]
MDSPFKPDVVRGQVALITGGGSGIGFEISSQFGKHGASIAIMGRRKQVLDDAVSALRSLGIQAIGLEGDVRKQEDARRVV
EATFQHFGKLDILVNAAAGNFLAAAEDLSPNGFRTVLDIDAVGTFNMCHAALKYLKKGAPGRDSSSGGGSIINISATLHY
TASWYQIHVSAAKAAVDATTRNLALEWGTDYDIRVNGIAPGPIGGTPGMSKLVPEEIENKTREYMPLYKVGEKWDIAMAA
LYLSCDSGKYVSGLTMVVDGGLWLSKPRHLPKEAVKQLSRAVEKRSRAKPVGLPTSKL*

DNA
ATGGACTCTCCGTTCAAACCTGATGTCGTCAGAGGTCAAGTGGCTCTCATCACCGGTGGTGGATCCGGTATCGGTTTTGA
GATCTCTTCTCAGTTTGGCAAACATGGAGCTTCTATCGCTATCATGGGACGACGAAAACAAGTCCTCGATGACGCCGTCT
CTGCTCTTCGATCTCTTGGAATCCAGGCTATTGGATTGGAAGGTGATGTTCGTAAGCAAGAAGATGCGAGAAGAGTTGTG
GAAGCAACTTTTCAGCATTTTGGTAAACTTGATATTCTTGTTAACGCCGCTGCTGGCAATTTTCTGGCTGCTGCTGAGGA
TTTGTCTCCTAATGGCTTCAGAACAGTCTTAGACATTGATGCGGTAGGAACATTCAACATGTGTCACGCAGCTCTCAAGT
ATCTTAAGAAAGGAGCGCCTGGAAGAGACTCATCAAGCGGTGGAGGTTCGATTATTAACATTAGCGCGACTTTGCACTAC
ACGGCTTCTTGGTACCAAATACATGTCTCTGCAGCCAAGGCTGCAGTTGATGCTACCACAAGAAACTTGGCATTGGAGTG
GGGAACTGACTATGATATTAGAGTGAACGGGATTGCTCCAGGTCCTATTGGAGGTACACCTGGAATGAGTAAACTTGTAC
CTGAGGAGATTGAAAACAAAACCAGAGAGTACATGCCTCTTTATAAAGTTGGAGAGAAGTGGGATATCGCTATGGCTGCA
CTCTACCTCAGCTGTGATTCTGGGAAATATGTGAGCGGACTAACAATGGTGGTAGATGGAGGACTGTGGCTTAGCAAACC
TCGCCACTTGCCTAAAGAAGCGGTGAAGCAACTCTCTCGTGCGGTGGAGAAGAGGTCTAGGGCCAAGCCTGTTGGTCTCC
CAACCAGCAAGCTGTAG