Details for Arabidopsis Locus AT3G12780

Position : Chr3 ( 5`- 4060971 .. 4063306 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12780

Protein [Map View]
MASAAASSAFSLLKSTGAVASSAGTRARASLLPIPSTSVSARPLGFSATLDSRRFSLHVASKVESVRGKGSRGVVSMAKK
SVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLS
ELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTK
FLKPSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEE
DKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMG
VFEMEKFAAGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPVT
V*

DNA
ATGGCTTCCGCTGCCGCAAGTTCCGCCTTTTCACTCCTTAAGTCCACCGGCGCTGTTGCTTCCTCCGCCGGAACTCGCGC
ACGTGCCTCCCTTCTGCCAATTCCCTCTACCTCTGTTTCCGCGCGTCCTCTAGGCTTCTCCGCCACTCTAGATTCCCGTC
GTTTCTCTCTCCACGTTGCTTCCAAAGTTGAATCGGTGCGTGGGAAGGGAAGCAGAGGAGTGGTTTCTATGGCGAAGAAG
AGCGTCGGAGATCTGACCTCAGCTGATTTGAAGGGGAAGAAGGTTTTCGTGAGAGCTGATCTCAATGTACCTCTCGATGA
TAATCAGACTATCACTGACGATACCAGAATCCGTGCCGCCATTCCAACGATCAAGTATTTGATTGAAAATGGTGCTAAAG
TTATCCTCTCCACTCATCTGGGAAGGCCAAAGGGAGTCACCCCAAAGTTTAGTTTGGCTCCTCTTGTCCCTAGGCTCTCC
GAGCTTCTTGGTATTGAGGTCACGAAAGCTGATGATTGTATTGGCCCAGAAGTGGAAAGCTTGGTGGCTTCTCTACCTGA
AGGTGGAGTTTTGCTTCTTGAGAACGTCAGGTTTTACAAGGAGGAAGAGAAGAACGATCCTGAGTTTGCTAAGAAGCTTG
CTTCTCTAGCTGACCTTTATGTCAATGATGCTTTCGGAACTGCTCACAGAGCTCATGCTTCTACCGAAGGAGTCACTAAG
TTCTTGAAGCCTTCAGTTGCTGGTTTCCTTTTGCAAAAGGAACTGGACTACCTAGTTGGTGCTGTTTCAAACCCAAAGAG
ACCATTTGCAGCCATAGTGGGTGGTTCCAAAGTCTCATCCAAGATTGGAGTTATTGAATCGCTTCTGGAGAAGTGTGATA
TTCTTCTTCTTGGTGGTGGAATGATCTTCACATTCTACAAGGCACAGGGTCTTTCAGTTGGTTCGTCCCTTGTTGAAGAA
GACAAGCTTGAATTGGCTACAGAACTCCTTGCCAAAGCTAAGGCCAAAGGAGTCTCTCTTTTGTTGCCAACAGATGTTGT
AGTTGCTGACAAGTTTGCTCCTGATGCCAACAGCAAGATTGTGCCTGCATCAGGCATTGAGGACGGATGGATGGGACTGG
ACATTGGTCCAGACTCTATCAAAACTTTCAACGAAGCTCTGGACACAACACAAACAGTCATTTGGAATGGACCTATGGGA
GTTTTCGAGATGGAAAAGTTTGCGGCTGGAACAGAGGCGATAGCGAATAAACTAGCAGAGCTAAGTGAAAAAGGAGTGAC
AACGATAATAGGAGGAGGAGACTCAGTGGCTGCAGTGGAGAAAGTAGGAGTAGCAGGAGTCATGAGTCACATCTCCACTG
GTGGTGGAGCCAGCTTGGAGCTGTTGGAAGGAAAAGTACTTCCCGGTGTGATCGCCCTTGATGAAGCAATCCCAGTCACT
GTTTAG