Details for Arabidopsis Locus AT3G12775

Position : Chr3 ( 5`- 4059772 .. 4060944 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12775

Protein [Map View]
MSNDSSNITNLFEGRDKGIGASSSDSDDDRAGSSTEQEEDESQNLVPESKPGSEGEKVGDIVRFGKDSYFVIDIFEKEIM
ELGDKVDLNYKRFKKFEAVDGGAPRDHHFYNYRCCYSSYLCVCASSTVDRLWGILERGLASREKEGVSFFVRTYKERKEL
MRVAVTVTDCYQNHNLYFFDLKFPKEYPYQAPSFYYHPYDLRLSTPEDQKSLRDKHCYNIVDVFLHIQEIVLMNTNKSCN
QMLDILERPLAGFQDFVIGYFRKKGPLILRNMLQEFDMEEERDKKMFWKMYFAFEGNKVYCEQILNSDLKAELEKLKEKE
YTLSDYYYGSSSSNYPTYTQRDDGIKKTSKSFWNKYLSVSFD*

DNA
ATGAGTAATGATAGTTCTAATATTACTAATCTCTTCGAAGGTAGGGATAAAGGTATTGGTGCAAGCAGCAGCGACTCTGA
TGATGATCGAGCAGGTTCTTCTACTGAGCAGGAAGAAGATGAATCCCAAAACCTTGTACCGGAGTCTAAACCGGGATCGG
AAGGTGAAAAAGTGGGTGACATCGTTCGTTTTGGTAAAGACAGTTACTTCGTTATTGATATCTTCGAGAAAGAGATCATG
GAGTTAGGAGACAAAGTGGATTTAAACTACAAGAGATTCAAAAAGTTCGAAGCTGTTGATGGAGGCGCTCCGCGAGATCA
TCACTTCTACAACTACCGTTGCTGTTACTCCTCTTATTTATGCGTCTGCGCGAGTAGTACTGTGGATAGATTGTGGGGGA
TTCTAGAGAGGGGTCTAGCCTCCAGAGAGAAGGAAGGCGTCAGCTTCTTCGTGAGAACTTACAAAGAGAGAAAAGAGCTG
ATGAGAGTTGCTGTCACTGTAACAGATTGTTATCAGAATCATAATTTGTACTTCTTCGACCTCAAGTTCCCCAAGGAGTA
TCCATATCAAGCACCGAGTTTCTATTACCATCCGTATGACCTTCGTTTGAGTACTCCTGAAGACCAAAAGTCACTGAGAG
ATAAGCACTGCTACAACATCGTAGATGTGTTTCTCCACATTCAAGAGATTGTGTTGATGAACACTAACAAGTCATGTAAC
CAGATGCTAGATATCCTGGAACGGCCACTCGCGGGGTTTCAAGATTTCGTAATAGGGTATTTTAGGAAGAAGGGGCCTTT
GATTCTGCGGAACATGCTGCAAGAGTTTGATATGGAGGAAGAGAGGGACAAGAAAATGTTCTGGAAGATGTACTTTGCGT
TTGAAGGCAATAAAGTTTATTGTGAGCAGATTCTCAACAGTGATCTGAAAGCAGAGCTGGAGAAATTGAAGGAGAAAGAG
TATACATTAAGCGATTACTACTATGGCTCATCATCTTCCAACTACCCAACCTACACTCAAAGGGATGATGGTATCAAGAA
GACTTCCAAAAGCTTTTGGAACAAGTACTTGTCTGTGTCTTTTGATTGA