Details for Arabidopsis Locus AT3G12760

Position : Chr3 ( 5`- 4054739 .. 4056980 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12760

Protein [Map View]
MHKLSRSNRDKLQQFVAITGASEKNALQALKASDWHLEAAFDVFYSQPQPRSNAAEVRRLEELYNRYKDPYSDMILAEGI
SVLCNDLEVEPQDIVTLVLSWHMNAATACEFSRQEFISGLQALGVDSIGKLQEKLPFMRSELKDEQKFHEIYNFAFGWAK
EKGQKSLALDTAIGMWQLLFAEREWPLVTHWCDFLQDRHNKAISKDTWAQLLEFSRMVDPVLSNYDAEGAWPYLIDEFVE
YLYDKNVVEK*

DNA
ATGCATAAGTTGAGCAGAAGCAACCGTGACAAACTTCAGCAGTTCGTGGCTATCACAGGAGCTAGTGAGAAGAATGCTCT
TCAGGCTCTCAAAGCCAGTGATTGGCACCTTGAAGCAGCGTTTGATGTGTTTTACAGCCAGCCTCAACCAAGAAGCAATG
CTGCTGAAGTAAGACGCTTGGAGGAGCTCTACAATAGATATAAAGACCCGTATTCTGATATGATTCTTGCGGAGGGTATC
TCGGTTCTGTGTAATGATCTTGAGGTGGAACCGCAAGACATAGTCACGTTGGTTCTTTCGTGGCATATGAATGCTGCAAC
AGCGTGTGAGTTTTCCAGGCAAGAATTTATCAGTGGATTACAGGCATTAGGTGTAGATTCAATCGGGAAGTTGCAGGAAA
AGCTGCCATTTATGCGTTCTGAGCTTAAAGATGAACAAAAGTTCCATGAGATATACAACTTTGCTTTTGGGTGGGCGAAA
GAGAAGGGGCAGAAATCTCTTGCCTTAGACACAGCGATTGGGATGTGGCAGTTGCTCTTTGCAGAAAGAGAGTGGCCTTT
GGTAACTCACTGGTGTGATTTCTTGCAGGATCGTCATAACAAGGCCATATCTAAGGACACATGGGCACAGCTACTGGAAT
TTTCAAGGATGGTCGACCCAGTGCTGTCGAATTACGATGCAGAAGGAGCATGGCCTTACCTGATTGATGAATTCGTTGAG
TATTTGTATGACAAAAATGTCGTTGAGAAGTGA