Details for Arabidopsis Locus AT3G12730

Position : Chr3 ( 5`- 4047072 .. 4048614 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12730

Protein [Map View]
MMQSREEIRDDSSSGLVLTTDPKPRLRWTTELHERFVDAVTHLGGPEKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGKQ
PHKEHSQNHSICIRDTNRASMLDLRRNAVFTTSPLIIGRNMNEMQMEVQRRIEEEVVIERQVNQRIAAQGKYMESMLEKA
CETQEASLTKDYSTLFFDRTNICNNTSSIPIPWFEDHFPSSSSMDSTLILPDINSNFSLQDSRSSITKGRTVCLG*

DNA
ATGATGCAGTCGAGAGAGGAGATCAGAGATGATTCATCATCAGGTCTCGTCCTCACCACTGACCCTAAGCCTCGCCTTCG
CTGGACCACAGAGCTTCACGAACGCTTCGTTGACGCCGTCACTCACCTTGGAGGCCCTGAAAAGGCTACACCAAAGACAA
TAATGAGAGTTATGGGTGTGAAGGGTCTCACTCTTTATCATCTCAAGAGCCATCTCCAGAAGTTCAGACTTGGGAAGCAG
CCTCACAAGGAGCATAGTCAAAATCACTCCATTTGTATTAGAGATACAAATAGAGCTTCCATGTTGGATCTTCGAAGGAA
TGCTGTTTTCACGACTAGTCCGCTCATCATTGGTCGCAATATGAACGAGATGCAAATGGAGGTGCAAAGAAGGATAGAGG
AAGAGGTAGTAATAGAAAGACAGGTGAATCAAAGGATAGCGGCACAAGGGAAATACATGGAGAGCATGTTAGAGAAAGCA
TGTGAAACCCAAGAAGCAAGCCTCACTAAAGACTACTCTACTCTATTTTTCGACCGCACCAATATTTGTAACAACACATC
GTCCATCCCAATCCCATGGTTCGAGGATCATTTTCCTTCCTCTTCCTCCATGGACTCTACGTTGATTCTCCCCGACATCA
ATTCCAACTTCTCCCTACAAGATTCTAGGAGTTCCATCACTAAGGGCCGTACGGTTTGTCTCGGTTAG