Details for Arabidopsis Locus AT3G12685

Position : Chr3 ( 5`- 4029183 .. 4030355 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12685

Protein [Map View]
MLMKHCFVSHNANDLCFSFSNSKFNLASCPKKPPRLTCVVNVGFQDIAEVIHNKVLIAAGTSAVIGQLSKPFTSVVLYGK
NLDFRSVFQAGGFPSTHSSSVVAAATAIAFERGFADSIFGLTVVYAGLIMYDAQGVRREVGKHAKVLNKLTANARRSEVM
SLKGNESNKALTSEEISEEIAPPLKESIGHTEVEVIAGALFGFLVTLSVYSLM*

DNA
ATGTTGATGAAGCACTGTTTTGTGTCTCATAACGCCAATGATCTCTGTTTCTCTTTCTCCAACTCCAAATTCAATCTTGC
AAGCTGCCCAAAGAAGCCACCTCGTCTCACCTGCGTTGTCAATGTTGGATTCCAAGATATCGCTGAGGTCATCCACAACA
AGGTACTCATAGCTGCTGGGACTTCTGCTGTGATTGGGCAGCTCTCAAAGCCATTCACTTCTGTCGTTTTGTATGGGAAA
AATCTGGACTTTAGAAGTGTCTTTCAAGCTGGAGGTTTCCCTTCAACACATTCTTCTTCTGTTGTGGCTGCAGCAACTGC
TATTGCTTTTGAAAGGGGATTTGCTGACTCCATTTTTGGTCTAACTGTGGTTTATGCTGGCCTTATCATGTATGATGCCC
AGGGGGTGAGGAGAGAAGTTGGAAAACATGCCAAAGTGTTGAACAAACTAACAGCTAATGCTCGTAGAAGTGAAGTAATG
AGTTTAAAGGGCAACGAATCTAACAAAGCTTTGACATCAGAAGAGATCAGTGAGGAGATTGCTCCTCCATTGAAAGAATC
AATAGGACACACTGAAGTTGAAGTCATAGCAGGGGCTTTGTTCGGTTTCTTAGTTACCCTCAGTGTTTATTCCCTGATGT
AA