Details for Arabidopsis Locus AT3G12680

Position : Chr3 ( 5`- 4025076 .. 4029140 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12680

Protein [Map View]
MAHRQLYSYALQPSYAAAASTVSPAPPPPQQPLPPKTGLSSLYGSSADHYFPDTTYRFLARDGSEALSNYSGTLASSSSM
YHHLPNTTASHLAYPQLLQHQEVAWPPGVEVPGAASAVEPLPPGVKRTSEALYYPTLLGAHNTIGQTEAWYTTDYFTKRP
KLESTSHLPIYPQRAGEKDCTHYMQTRTCKFGESCRFDHPIWVPEGGIPDWKEAPVVPNEEYPERPGEPDCPYYIKTQRC
KYGSKCKFNHPREEAAVSVETQDSLPERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLTSEPDATN
NPHVTFTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLVTPATS
FYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPADRLSAMTKQAPQQPNVKLSLAGYPRREGALNCP
YYMKTGTCKYGATCKFDHPPPGEVMAKTTSEADAAGATNTDTTQ*

DNA
ATGGCACATCGTCAATTGTATAGCTACGCCCTTCAACCTTCTTATGCTGCTGCTGCCTCCACCGTATCTCCAGCTCCTCC
TCCGCCGCAACAACCACTGCCGCCAAAAACCGGTCTTTCTTCTCTCTACGGTTCTTCTGCTGACCATTACTTTCCGGATA
CCACGTATCGTTTCTTAGCTCGTGATGGATCCGAAGCTTTGAGCAACTATTCAGGGACTCTTGCATCGTCTTCCTCTATG
TACCATCATTTGCCTAACACGACGGCATCGCATTTGGCGTATCCTCAGCTGCTTCAGCATCAGGAAGTTGCTTGGCCACC
TGGTGTGGAGGTTCCCGGTGCTGCTTCCGCCGTCGAGCCACTTCCTCCTGGTGTCAAACGCACCTCTGAAGCGCTCTACT
ATCCGACTCTGTTGGGTGCCCATAATACAATTGGTCAAACCGAAGCTTGGTATACTACAGACTATTTTACCAAGCGCCCT
AAGTTGGAGAGTACAAGCCATTTGCCTATATATCCACAGAGGGCAGGAGAGAAAGATTGTACCCACTATATGCAAACAAG
AACATGTAAATTTGGAGAAAGCTGCAGGTTTGATCATCCTATTTGGGTTCCTGAGGGCGGAATCCCAGATTGGAAAGAGG
CACCAGTTGTTCCAAATGAAGAGTATCCTGAGAGACCAGGAGAACCAGATTGTCCTTACTATATAAAAACACAACGCTGC
AAATATGGTTCAAAGTGCAAATTTAATCATCCAAGAGAAGAGGCTGCAGTTAGTGTTGAAACTCAAGATTCATTGCCTGA
GAGGCCTTCTGAACCTATGTGCACATTCTACATGAAGACTGGAAAATGTAAATTTGGTTTGTCATGCAAATTCCACCATC
CAAAGGATATCCAGCTACCATCATCGAGTCAAGATATTGGTAGCAGTGTGGGGTTAACCAGTGAGCCTGATGCCACAAAC
AATCCGCATGTCACATTTACCCCAGCATTGTATCACAACTCAAAAGGACTACCTGTTAGATCGGGTGAAGTGGACTGCCC
ATTCTATCTCAAAACGGGAAGCTGCAAGTATGGAGCCACTTGTCGCTACAATCATCCTGAGAGGACTGCATTCATTCCCC
AAGCTGCTGGGGTAAACTATTCTCTAGTTTCATCGAACACTGCGAATTTGAACCTTGGGCTGGTTACACCAGCTACCTCT
TTCTATCAGACTCTTACTCAACCCACGCTTGGAGTGATTTCAGCAACTTATCCCCAAAGACCTGGACAATCAGAATGTGA
CTACTACATGAAGACAGGGGAGTGCAAGTTTGGAGAGAGATGCAAATTCCATCACCCAGCAGATAGGTTAAGTGCAATGA
CCAAACAAGCTCCTCAACAACCAAATGTAAAGCTGAGTCTTGCAGGGTATCCCAGAAGAGAGGGTGCGCTTAATTGCCCT
TATTACATGAAGACAGGAACTTGCAAATACGGGGCAACATGCAAGTTTGACCATCCTCCTCCAGGTGAGGTGATGGCTAA
GACCACTTCAGAAGCCGATGCTGCTGGAGCAACCAACACCGACACTACTCAATGA