Details for Arabidopsis Locus AT3G12660

Position : Chr3 ( 5`- 4019060 .. 4019827 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12660

Protein [Map View]
MSSSLTIFFFFFASTFLYTSSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTSVIK
KILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSAVPGSSLDAQLQDTVAALPFNI
SVLHISSAIMIDVKGDNAPTASPLSPVSSPPRPAESPNDDGQDFDEPPSSAPGAAADEPSENAGSANGVSRNDSQPAFAF
TLLMSFIWWFMARLR*

DNA
ATGTCTTCTTCACTTACAATCTTCTTCTTCTTTTTTGCTTCCACATTCCTCTACACTTCATCAAATTCATTCAACATCAC
TAACATCTTAAACGAGCACGATGATTTCTCAAATTTCAACCAGCTTCTCTCCGAAACTCAGCTCGCTTCTACCATCAACA
AACGTCAAACCATAACCGTCCTTGTGGTTTCCAACGGTGCACTCTCCTCTCTCTCTGGCCAACCAACCTCCGTCATCAAG
AAAATCCTTAGCCTTCACATTGTTTTAGATTACTACGACCAGAAGAAACTCAAGAATCTGAGCAAGAAAACAGTACTCCT
CACCACTCTTTTCCAATCTAGCGGTCTAGCCAGAGGCCAACAAGGGTTCTTGAACGCAACCGTTATGAAAAACGGAGACG
TGGCGTTTGGTTCTGCGGTTCCTGGGTCTAGCCTTGATGCTCAGCTTCAAGACACTGTAGCAGCACTACCGTTTAACATC
TCTGTGCTTCATATTAGTAGTGCTATAATGATTGATGTTAAAGGTGATAATGCACCTACTGCTTCTCCTTTGTCACCGGT
ATCATCTCCACCACGCCCTGCAGAATCACCTAATGATGATGGTCAAGATTTTGACGAGCCACCATCCTCTGCTCCTGGTG
CTGCTGCTGATGAACCTTCCGAAAACGCCGGCTCAGCTAATGGAGTTTCAAGAAACGATTCTCAGCCCGCTTTCGCGTTT
ACGCTGTTGATGTCATTCATTTGGTGGTTCATGGCTCGACTTCGATGA