Details for Arabidopsis Locus AT3G12630

Position : Chr3 ( 5`- 4012608 .. 4013583 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12630

Protein [Map View]
MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVESGSILKRSARSVNLRSSPAKV
VIRPREIDAVKKRDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENPVVKAAKMVKV
*

DNA
ATGGCTCAGAGAACGGAGAAGGAAGAGACCGAGTTCAAAGTTCTCGAAACCTTGACGACAACAACAACGACGTTATGTAC
CAATAACTGCGGCGTTACAGCGAATCCTGCGACGAACAACATGTGTCAGAAATGTTTCAACGCATCTCTCGTCTCGGCGG
CCGCAGGTGTTGTTGAATCAGGTTCGATCTTGAAGAGATCGGCTAGATCTGTCAATCTTCGTTCGTCACCAGCTAAAGTC
GTGATTCGTCCAAGAGAGATCGATGCGGTGAAGAAGAGAGATCAACAGATCGTAAACCGATGTTCTGGTTGTCGGAAGAA
AGTTGGGTTGACCGGATTCAGGTGCCGATGCGGTGAGCTTTTCTGCTCAGAGCACCGTTACTCCGATCGTCATGATTGTA
GCTACGACTACAAAACCGCTGGTCGTGAGGCGATCGCTAGAGAAAATCCGGTGGTCAAGGCTGCGAAAATGGTCAAAGTT
TAA