Details for Arabidopsis Locus AT3G12610

Position : Chr3 ( 5`- 4006399 .. 4007807 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12610

Protein [Map View]
MRKLLASPFSSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISL
RGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSK
LAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSK
NHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIP
DSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPLTTSC*

DNA
ATGAGAAAGTTGTTGGCATCGCCGTTTAGTTCATTACTCGCCGTCGTTTTCATTTCCGTCATCTCCGTCGTCAGATGCTG
CTCTCCTAAAGATCAGACGGCTCTCAATGCTTTCAAGTCGTCACTGAGCGAACCAAACCTCGGTATCTTCAACACTTGGT
CTGAAAACACTGATTGTTGCAAGGAATGGTACGGTATCAGCTGCGATCCTGATTCGGGTCGGGTCACTGATATTTCTCTC
CGGGGAGAATCTGAAGACGCCATTTTCCAAAAGGCAGGCCGGTCCGGTTATATGTCCGGTTCGATTGATCCAGCAGTTTG
TGACTTAACCGCACTCACTTCCCTCGTTCTCGCCGACTGGAAAGGAATCACCGGAGAGATTCCTCCGTGCATTACTTCCC
TAGCTTCGCTCCGTATCCTCGATCTCGCCGGCAACAAGATCACCGGGGAGATTCCCGCGGAAATCGGCAAACTCTCGAAA
CTCGCTGTTTTAAACCTCGCCGAGAATCAAATGTCCGGCGAGATTCCGGCGTCACTGACGTCACTCATCGAGTTGAAGCA
TCTTGAATTGACGGAAAATGGAATCACCGGCGTGATCCCGGCCGATTTCGGATCGTTGAAGATGTTGAGCAGAGTTTTAC
TGGGCCGTAACGAACTAACCGGGTCAATTCCAGAGTCGATCTCGGGTATGGAACGGTTAGCGGATCTGGATCTATCCAAA
AACCATATCGAAGGTCCGATACCCGAATGGATGGGTAACATGAAGGTACTCTCACTTTTGAATCTCGATTGCAATTCGTT
AACCGGTCCAATCCCCGGTTCGCTTCTTAGCAATTCCGGTTTAGATGTTGCCAATTTGAGCCGAAATGCGTTGGAAGGAA
CTATACCCGACGTTTTCGGGTCAAAAACGTATTTAGTTTCGCTTGATCTGTCACACAATAGTCTATCGGGTCGGATCCCG
GATTCGTTGTCGTCAGCTAAGTTTGTGGGACATTTGGATATTAGCCATAACAAGCTTTGTGGGCGTATTCCAACGGGTTT
TCCTTTTGATCACCTTGAAGCTACGTCGTTTAGTGACAACCAATGTCTCTGCGGTGGCCCTTTGACGACGTCATGTTAA