Details for Arabidopsis Locus AT3G12600

Position : Chr3 ( 5`- 4004512 .. 4006198 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12600

Protein [Map View]
MCDLVARTGRLQQRYEDGSRLVAGCIPFRYVNSDKDGNSESGKVIQVLMISSSSGPGLLFPKGGWENDETVREAAAREAV
EEAGVRGILMDFLGNYEFKSKSHQDEFSPEGLCKAAMYALYVKEELATWPEHETRTRKWLTIEEAVESCRHPWMKDALVE
GFCKWHKEKMVKGEEITGEH*

DNA
ATGTGTGATTTGGTCGCGCGTACGGGTCGTCTCCAGCAGCGGTACGAGGATGGCTCTCGTCTCGTCGCCGGGTGTATTCC
GTTTAGGTATGTAAATTCTGACAAAGATGGTAATTCTGAATCTGGGAAAGTGATTCAAGTGTTGATGATCAGCTCGTCTA
GTGGACCTGGACTTTTGTTTCCCAAGGGAGGATGGGAGAATGATGAGACAGTCAGGGAGGCTGCAGCGAGGGAAGCAGTG
GAAGAAGCAGGAGTCCGTGGGATTCTTATGGATTTTTTGGGGAATTATGAGTTCAAGAGCAAATCACACCAAGATGAGTT
TAGCCCAGAAGGTTTATGTAAAGCGGCAATGTACGCGTTGTATGTGAAAGAAGAGCTAGCGACGTGGCCGGAACATGAGA
CGAGAACACGTAAATGGCTGACAATTGAAGAAGCGGTAGAGAGTTGCAGGCACCCTTGGATGAAGGACGCATTGGTGGAA
GGATTCTGTAAATGGCATAAGGAGAAGATGGTTAAAGGAGAGGAGATAACTGGTGAACATTGA