Details for Arabidopsis Locus AT3G12587

Position : Chr3 ( 5`- 3994366 .. 3995538 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12587

Protein [Map View]
MIDDQDLGFIANFLGIFIFALVIAYHYVTADPKYEAT*

DNA
ATGATCGATGATCAGGACTTGGGGTTTATTGCCAACTTTCTTGGCATCTTCATCTTCGCATTGGTAATTGCTTATCACTA
CGTAACTGCTGATCCCAAATACGAAGCCACTTGA