Details for Arabidopsis Locus AT3G12570

Position : Chr3 ( 5`- 3988670 .. 3991079 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12570

Protein [Map View]
MGETLITTLSMENYHPSTLLSMDSGAFTHEESERDMNGSLILTGPPDINLPLSSEARPSLLLWNEHCDILDVGLGPQLYE
PEAVVHVPKVAKKYNKRVDSAWGAWLFFSFYFKPVLDEKSKSKLTRDSNGLSGYDKSDLQLDSFLVQHDMENMYMWVFKE
KPENALGKMQLRSYMNGHSREGERPFPFSVDKGFVRSHRMQRKHYRGLSNPQCLHGIEVVYSPNLSVLSEDEKKKWTELT
GRDVNFAIPAEASDYGSWRNLPNTEFEAERPLPLAKANGHTHLKKLNGTCLNLSTHSPDHAVDTVEVQLAGSNKRKRDCL
ALGNCDDSSSSEKSLDMKIHATELPWSNDFSGVMKNVYGPVTAAKTIYEDDRGFLIVMSLPFVDSGRVKVTWRNTPAHGI
VKISCVSTACEPFIKRHDRTFKLTDPTPEHCPPGEFVREVSLPNRIPDDAKLEAYRDETGTTLEVLVPKHRMGPEEHEVR
VCLRPFVLE*

DNA
ATGGGTGAGACTCTCATCACCACCCTGTCTATGGAGAACTATCACCCGTCAACACTGCTATCCATGGATTCAGGTGCTTT
TACTCATGAAGAATCAGAGAGGGATATGAATGGGTCTCTCATACTTACTGGACCGCCTGATATTAATCTACCACTCTCTT
CTGAAGCTAGGCCATCTCTGCTTTTGTGGAACGAACACTGTGACATCTTAGACGTTGGACTTGGACCTCAGCTATATGAG
CCTGAGGCTGTTGTTCATGTGCCTAAGGTTGCTAAGAAGTACAACAAGCGTGTTGATAGTGCATGGGGTGCTTGGCTTTT
CTTCAGTTTCTACTTCAAACCTGTTTTGGATGAGAAGTCTAAAAGTAAGTTAACGAGGGACAGCAATGGCTTGTCTGGGT
ATGATAAATCTGATTTGCAGCTCGACTCGTTCTTGGTTCAGCATGACATGGAGAATATGTACATGTGGGTGTTCAAGGAA
AAGCCTGAAAATGCCCTTGGCAAGATGCAGCTGCGGAGCTACATGAACGGACACTCACGCGAGGGTGAGCGTCCTTTCCC
TTTTAGTGTGGACAAAGGTTTTGTCCGCTCTCATAGGATGCAGAGGAAACATTACCGTGGTCTCTCTAACCCACAGTGCC
TCCATGGAATCGAAGTTGTTTATTCACCCAACCTTTCTGTACTCAGCGAGGATGAAAAGAAGAAGTGGACAGAACTCACA
GGTCGAGATGTGAACTTTGCTATTCCAGCTGAAGCTAGTGATTACGGTTCATGGAGGAATCTCCCAAACACCGAATTTGA
GGCTGAGAGACCTCTTCCTCTGGCTAAAGCTAACGGGCACACCCACCTGAAAAAGCTGAATGGTACCTGTCTAAACCTGT
CTACACATTCCCCAGACCATGCAGTTGATACAGTGGAAGTTCAACTCGCTGGTAGCAATAAACGCAAAAGGGATTGTCTT
GCTCTAGGAAACTGCGATGACTCGAGCTCAAGTGAGAAATCTCTGGACATGAAAATCCATGCAACGGAGCTGCCTTGGTC
AAATGATTTTAGCGGGGTGATGAAGAATGTGTACGGTCCAGTCACAGCCGCAAAAACGATATATGAAGACGACAGAGGGT
TCTTGATAGTTATGAGCCTGCCATTTGTTGATTCCGGAAGGGTGAAAGTGACATGGAGGAATACACCAGCACATGGAATA
GTGAAGATATCATGTGTAAGTACAGCATGTGAGCCATTCATCAAGAGACATGATAGAACATTTAAGCTAACAGATCCAAC
ACCAGAGCATTGCCCACCGGGGGAATTTGTCCGCGAAGTCTCCCTGCCGAACAGGATTCCAGATGACGCCAAGCTTGAAG
CTTACCGGGACGAAACAGGAACAACACTAGAGGTTTTAGTGCCTAAACACCGAATGGGACCAGAGGAGCATGAGGTTCGC
GTCTGTCTCCGTCCGTTCGTGCTAGAGTGA