Details for Arabidopsis Locus AT3G12550

Position : Chr3 ( 5`- 3978005 .. 3981762 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12550

Protein [Map View]
MNNKLSDFEKNLYKKLKSGKLEVKVSYRTFLCPYCPDNKKKVGLYVDILQHASGVGNSQSKKRSLTEKASHRALAKYLIK
DLAHYATSTISKRLKARTSFIPAETGDAPIIYDDAQFEKLVWPWKGVLVNIPTTSTEDGRSCTGESGPKLKDELIRRGFN
PIRVRTVWDRFGHSGTGIVEFNRDWNGLQDALVFKKAYEGDGHGKKDWLCGATDSSLYAWLANADDYYRANILGENLRKM
GDLKSIYRFAEEEARKDQKLLQRLNFMVENKQYRLKKLQIKYSQDSVKLKYETEEKEKILRAYSEDLTGRQQKSTDHFNR
IFADHEKQKVQLESQIKELEIRKLELAKREAENETQRKIVAKELEQNAAINSYVQLSALEQQKTREKAQRLAVDHKMQKE
KLHKRIAALERQLDQKQELELEVQQLKSQLSVMRLVELDSGSEIVNKVETFLRDLSETEGELAHLNQFNQDLVVQERKSN
DELQEARRALISNLRDMGLHIGVKRMGELDTKPFMKAMRIKYCQEDLEDWAVEVIQLWEEYLKDPDWHPFKRIKLETAET
IVEVIDEDDEKLRTLKNELGDDAYQAVANALLEINEYNPSGRYISSELWNFREDRKATLEEGVNSLLEQWNQAKHLKS*

DNA
ATGAACAACAAATTGAGTGATTTTGAGAAAAATCTGTACAAAAAACTCAAGAGTGGAAAGCTCGAGGTGAAAGTCTCATA
CCGGACTTTCCTGTGTCCTTATTGTCCCGATAATAAGAAGAAGGTTGGTTTGTATGTTGACATTCTTCAGCATGCTTCTG
GAGTTGGTAATAGCCAATCCAAGAAAAGAAGTTTGACTGAGAAGGCTAGTCACCGTGCTCTTGCCAAATACCTTATTAAA
GATCTTGCTCATTACGCTACTTCTACTATATCTAAGCGCTTAAAAGCCAGAACATCATTCATTCCTGCTGAAACCGGCGA
TGCTCCTATAATTTATGATGATGCTCAGTTCGAGAAACTTGTGTGGCCTTGGAAAGGAGTTTTGGTTAATATTCCCACGA
CGAGTACAGAAGATGGTCGGTCTTGTACTGGAGAGAGTGGACCAAAACTTAAGGATGAATTAATCCGAAGAGGATTCAAC
CCAATTAGAGTTCGTACTGTGTGGGACCGTTTCGGTCATTCGGGAACCGGAATAGTGGAATTTAACAGAGACTGGAATGG
ACTTCAAGATGCTTTGGTGTTTAAGAAGGCTTATGAAGGAGATGGGCATGGGAAAAAGGATTGGCTTTGTGGTGCTACTG
ACTCGAGCCTTTATGCATGGCTTGCCAATGCTGATGATTACTACAGGGCTAACATTTTAGGAGAAAACTTGCGGAAGATG
GGTGACCTCAAAAGTATTTATAGGTTTGCAGAAGAAGAGGCAAGGAAAGACCAAAAGCTTTTGCAGCGTCTGAACTTTAT
GGTTGAGAACAAACAATATCGGTTGAAGAAATTACAGATAAAATATTCACAGGATTCAGTTAAACTTAAGTATGAGACTG
AAGAAAAAGAAAAGATTCTCCGTGCTTACAGTGAAGATCTGACAGGAAGACAACAAAAATCGACTGATCATTTCAATAGG
ATCTTTGCTGATCATGAAAAGCAAAAGGTGCAGCTGGAGTCTCAGATAAAGGAACTTGAAATTAGAAAGTTGGAGTTGGC
AAAACGTGAGGCAGAGAATGAAACGCAGAGGAAAATAGTGGCAAAAGAACTTGAACAGAATGCTGCTATAAATAGTTATG
TTCAACTATCTGCCTTGGAACAACAAAAGACCAGAGAGAAAGCGCAAAGATTGGCTGTAGATCACAAGATGCAAAAGGAA
AAGCTTCATAAGAGAATTGCTGCACTAGAAAGGCAGCTTGATCAGAAGCAGGAGCTTGAACTGGAGGTCCAGCAACTGAA
AAGTCAGCTGAGCGTGATGAGACTCGTGGAATTGGACAGTGGTTCTGAAATTGTGAACAAGGTGGAGACCTTCCTCAGAG
ACCTTAGTGAGACAGAAGGAGAGCTTGCACACTTAAATCAATTCAATCAAGATCTTGTTGTTCAAGAGCGGAAGAGCAAT
GATGAACTTCAAGAAGCTCGAAGAGCATTGATAAGCAATTTGAGAGACATGGGATTGCATATTGGTGTTAAGAGAATGGG
GGAGCTTGACACCAAACCGTTTATGAAAGCAATGAGAATAAAGTACTGTCAAGAAGATCTAGAGGATTGGGCAGTTGAAG
TTATCCAGCTTTGGGAGGAATATCTTAAGGACCCAGATTGGCATCCTTTTAAACGGATAAAGCTTGAGACTGCAGAAACA
ATAGTGGAAGTAATTGATGAGGATGACGAGAAGTTAAGAACCCTGAAGAATGAACTGGGGGATGATGCGTACCAAGCAGT
GGCAAATGCATTGCTGGAGATAAACGAGTATAATCCGAGTGGAAGGTACATCTCCTCAGAGCTATGGAACTTCAGAGAAG
ACAGGAAGGCTACGCTTGAGGAAGGTGTTAATTCTCTACTGGAGCAATGGAATCAAGCGAAGCATCTCAAGTCATAA