Details for Arabidopsis Locus AT3G12530

Position : Chr3 ( 5`- 3972346 .. 3974195 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12530

Protein [Map View]
MAGQTDPHISLFSPQEVEFMAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMSVD
NLTQILEAERESQSTFQALPFSYVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKLETNLGSFQGTSAVKISNVSAM
EVNIVRPFVIRALEAFYKHDKPEADVDRDTRSSRQQRETNNEPRRPLRQR*

DNA
ATGGCTGGCCAGACTGATCCTCATATTTCACTGTTTTCTCCACAAGAGGTTGAGTTTATGGCAGAGGACGAGCTGGTCGA
GATTGTTCCTAATATGAACATGGAGCAACTCAATTTCATCAGTGGCGATTTCGGTCGGTTCATTCCTCAGATTCCGACAA
AGGTGCCTCTGTGGCTTGCAGTGGCACTGAAGAGGAGAGGAAAATGCACTTTCCGGCCTCCGGGGTGGATGTCTGTTGAT
AATTTGACTCAGATCTTGGAAGCAGAACGTGAATCTCAGTCGACATTCCAGGCATTACCATTTAGTTACGTGGAGATTGC
CAGACTACTTTTTGACCATGCACGTGACGATATTCCAGACATGTATATGGTGAGATCCCTAGTCGAGGACATCAGAGATG
TACGGCTTCACAAACTTGAGACTAACTTAGGATCATTTCAAGGTACATCTGCAGTAAAGATCTCTAATGTATCGGCAATG
GAAGTAAACATAGTACGCCCATTTGTGATAAGAGCCTTAGAAGCATTTTATAAGCATGACAAGCCAGAGGCTGATGTAGA
CAGAGACACCAGAAGTAGTAGACAACAGCGTGAAACCAACAATGAACCAAGGAGACCTCTAAGGCAACGCTAG