Details for Arabidopsis Locus AT3G12510

Position : Chr3 ( 5`- 3967095 .. 3967822 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12510

Protein [Map View]
MGDSKRQKTETETKMEMEKVEKKEASGSVNFAELRDDLFREAAKLVSEDPSTKIAIFVTPPPSSSESDVSMFSFGFPSVN
GVVNTFLENNPAPVDDAEEEDEDEEDAEVEHPRFWWEDTKQFESMNPEQLNAACQRMLRLKERLNLELDAMLKAEASGNQ
KDPHNDKAADPKT*

DNA
ATGGGAGATTCTAAGAGGCAAAAGACGGAGACGGAGACGAAGATGGAGATGGAGAAGGTAGAGAAGAAGGAAGCATCAGG
ATCTGTTAATTTCGCAGAACTACGCGACGATCTCTTCCGCGAAGCAGCGAAACTTGTCTCCGAAGATCCCTCCACCAAAA
TCGCCATCTTCGTTACTCCTCCTCCTTCTTCCTCCGAATCGGACGTCTCTATGTTCTCCTTCGGCTTTCCCTCTGTCAAT
GGCGTTGTTAACACTTTCCTCGAGAATAATCCAGCACCAGTGGATGATGCGGAGGAGGAAGATGAAGACGAGGAGGATGC
GGAGGTTGAGCACCCAAGGTTTTGGTGGGAAGATACTAAGCAATTCGAATCGATGAATCCAGAGCAATTGAACGCTGCGT
GTCAGAGGATGCTGAGGCTGAAGGAACGTTTGAATCTCGAACTTGACGCTATGCTGAAAGCTGAAGCTTCTGGAAATCAA
AAGGATCCTCACAACGACAAAGCTGCTGACCCCAAAACCTAA