Details for Arabidopsis Locus AT3G12500

Position : Chr3 ( 5`- 3962382 .. 3963984 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12500

Protein [Map View]
MPPQKENHRTLNKMKTNLFLFLIFSLLLSLSSAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQSQCTPGGTPP
GPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAP
DGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIW
FWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGVNPGGNLDC
YNQRSFVNGLLEAAI*

DNA
ATGCCTCCACAAAAAGAAAACCATAGAACATTGAACAAAATGAAGACTAATCTTTTTCTCTTTCTCATCTTTTCACTTCT
CCTATCATTATCCTCGGCCGAGCAATGTGGTCGCCAAGCTGGAGGAGCACTCTGCCCCAACGGTCTATGCTGCAGCGAGT
TCGGCTGGTGCGGTAACACCGAACCATACTGTAAGCAGCCTGGCTGCCAAAGCCAGTGCACTCCCGGTGGTACTCCTCCT
GGACCCACCGGCGATCTTTCGGGCATCATTTCAAGTTCTCAGTTCGATGATATGCTTAAGCATAGGAATGATGCCGCTTG
TCCTGCTAGAGGTTTCTACACTTACAACGCCTTTATCACCGCTGCAAAGTCCTTCCCCGGTTTTGGCACCACCGGAGACA
CCGCCACGAGGAAGAAGGAGGTCGCCGCCTTCTTCGGCCAGACTTCCCATGAAACTACAGGTGGATGGGCTACAGCACCA
GACGGACCATATTCATGGGGCTACTGTTTCAAGCAAGAACAGAATCCTGCTTCAGACTACTGTGAACCGAGCGCCACGTG
GCCATGCGCATCTGGCAAACGCTACTACGGAAGAGGACCAATGCAACTGTCGTGGAACTACAATTACGGTCTATGCGGTA
GAGCAATAGGAGTTGACTTACTCAACAACCCTGACCTTGTTGCCAACGACGCAGTGATCGCTTTCAAAGCCGCGATTTGG
TTCTGGATGACTGCTCAGCCTCCCAAACCGTCTTGCCATGCCGTGATAGCCGGCCAGTGGCAGCCTTCAGACGCCGACCG
TGCCGCCGGGAGATTACCGGGTTATGGAGTGATTACGAACATCATTAACGGTGGATTGGAGTGTGGACGTGGCCAAGACG
GGAGAGTCGCCGATCGTATAGGGTTTTATCAGAGGTATTGTAACATATTTGGTGTTAATCCTGGTGGTAATCTTGATTGT
TACAACCAAAGATCCTTCGTTAACGGCCTCCTCGAAGCTGCTATTTAG