Details for Arabidopsis Locus AT3G12480

Position : Chr3 ( 5`- 3957777 .. 3960472 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12480

Protein [Map View]
MRKKLDTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFL
REVVSKVPDYGHSQGQGHGDVTMDDRSISKRRKPISDEVNDSDEEYKKSKTQEIGSAKTSGRGGRGRGRGRGRGGRAAKA
AEREGLNREMEVEAANSGQPPPEDNVKMHASESSPQEDEKKGIDGTAASNEDTKQHLQSPKEGIDFDLNAESLDLNETKL
APATGTTTTTTAATDSEEYSGWPMMDISKMDPAQLASLGKRIDEDEEDYDEEG*

DNA
ATGAGGAAGAAGCTCGATACTCGGTTCCCAGCTGCTCGTATTAAAAAGATTATGCAAGCTGATGAGGATGTTGGCAAGAT
AGCTTTGGCAGTGCCTGTCTTAGTCTCAAAATCTTTGGAGTTGTTCTTGCAAGACCTTTGTGATCGTACATATGAAATTA
CCCTTGAAAGAGGTGCCAAGACTGTGAGCTCATTGCACCTAAAACATTGTGTGGAAAGATATAACGTGTTTGATTTTCTG
AGGGAAGTTGTGAGTAAGGTGCCTGACTATGGCCATTCCCAAGGGCAAGGACATGGTGATGTTACCATGGATGATCGCAG
CATCTCCAAGAGAAGGAAGCCCATCAGCGATGAAGTGAATGACAGTGACGAGGAATATAAGAAAAGCAAAACGCAAGAGA
TAGGGAGTGCTAAGACCAGTGGCAGGGGTGGTAGAGGAAGAGGGCGAGGAAGAGGTCGTGGTGGACGAGCTGCAAAAGCA
GCCGAAAGAGAGGGTCTCAACCGCGAGATGGAAGTAGAAGCCGCCAATTCTGGACAGCCACCACCAGAAGACAATGTCAA
GATGCATGCGTCAGAGTCATCACCACAAGAGGATGAGAAGAAAGGCATCGACGGCACAGCAGCATCGAACGAAGACACCA
AGCAACACCTTCAAAGTCCCAAAGAAGGCATTGACTTTGATCTCAACGCTGAATCCCTCGACCTAAACGAGACCAAACTG
GCACCAGCCACAGGCACAACCACAACCACAACTGCAGCAACAGACTCTGAGGAGTATTCGGGCTGGCCTATGATGGACAT
AAGCAAAATGGATCCAGCACAGCTTGCTAGTCTGGGTAAGAGGATAGACGAGGATGAGGAAGATTATGACGAAGAAGGCT
AA