Details for Arabidopsis Locus AT3G12380

Position : Chr3 ( 5`- 3938276 .. 3941900 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12380

Protein [Map View]
MAFVSRIRRQSDYNTYPSSIPIVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKATVLLSSTGETVTIVGDLDPSMMKY
FDCTRSGPRSPFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYGVPAVAFGVDA
AFSYKYNQLHGICKKDGIVLCPGFTTTHSIPFVDGEPIYKGSSRTNIGGYHVTDYLKQLLSLKYPFHSSRFTWEKAEDLK
LEHCYIAPDYASEIRLFQEGRKEAEEKTSYWQLPWIPPPTEVPPSEEEIARKAAIREKQGQRLREMAEAKRVSKINDMEN
QLISLRFLLKQVDQVEEDDIPTFLSDTGYASRQELESTITKVTQSLRKARGEPKNEPAEYEENPDSLNNEKYPLMNVPDD
ILTPEQLKDKKRQMFLKTTAEGRLRARQKRNEEELEKEKRNQLEEERRRENPESYLEELQAQYKEVLERVEQKKRLKTNG
SSNGNNKSGGIGRGERLSAAQRERMRLLTTAAFDRGKGEDTFGSRDEDWQLYKLMSKDNDDDDEQPDSDEAELARLSSRL
QEIDPTFVQKVEGELSQTSGEVPRVRPLTEEDYKIVIGIERFRCPEILFHPNLIGIDQVGLDEMAGTSIRRLPHDEKELE
ERLTSSILMTGGCSLLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFAANLNFLGNAFTKMDYDEKGEDWL
RNYQIRYNYL*

DNA
ATGGCGTTCGTTTCGAGGATACGTAGGCAGAGTGATTACAATACATATCCATCTTCGATTCCCATTGTTATCGATAATGG
CGCTTCCTACTTCCGTATCGGGTGGGCAGGAGAAACTGAGCCTCGTGTTGTTTTCCGCAATATCGTGCAAAGACCACGCC
ACAAAGCTACAGTTCTTCTCTCTAGTACAGGTGAAACTGTTACTATTGTTGGCGACCTGGATCCTTCCATGATGAAGTAC
TTTGATTGCACTCGCTCTGGACCACGTTCCCCTTTTGACAGCAATGTGGTTTATCAGTTTGAGATCATGGAATATATTCT
TGACTACGCCTTTGATCGTTTGGGTGCTAATGGATCAGGGATTGATCATCCAATCCTAATCACTGAATGTGCATGCAACC
CAGTTCAATCTCGTAGCAAAATGGCAGAACTGCTATTTGAGACTTATGGAGTGCCTGCAGTTGCATTTGGAGTCGATGCT
GCTTTCAGCTACAAATACAATCAACTACATGGAATTTGTAAAAAAGATGGAATTGTTCTCTGTCCTGGATTCACGACAAC
ACACTCCATTCCGTTTGTCGACGGAGAACCTATATATAAAGGATCCAGCCGAACTAACATTGGTGGATATCATGTCACTG
ATTATTTAAAGCAGCTTCTGTCACTTAAGTACCCTTTTCATTCGTCTAGGTTTACATGGGAGAAGGCCGAAGATTTGAAA
TTGGAACACTGTTATATCGCACCTGACTATGCTTCGGAAATTCGGTTATTCCAGGAAGGAAGAAAAGAAGCTGAAGAGAA
AACAAGTTATTGGCAGCTTCCATGGATACCTCCTCCCACCGAAGTTCCTCCATCAGAAGAAGAGATTGCAAGGAAGGCAG
CTATAAGAGAAAAACAAGGTCAAAGGCTGCGAGAAATGGCTGAAGCAAAGAGAGTGTCCAAGATTAATGACATGGAGAAT
CAACTGATTAGCTTGCGTTTCCTTTTGAAGCAAGTTGACCAGGTTGAAGAGGATGATATTCCAACCTTTTTGTCAGACAC
CGGTTACGCGTCCAGGCAAGAGCTAGAGTCTACTATTACGAAAGTGACACAGTCGCTTAGAAAAGCAAGGGGTGAGCCGA
AGAATGAACCAGCTGAGTATGAAGAAAACCCTGATTCTCTTAATAATGAAAAGTATCCACTTATGAATGTCCCCGATGAT
ATTCTTACTCCTGAGCAGCTTAAGGACAAGAAGAGGCAAATGTTTCTTAAAACAACAGCAGAGGGCCGGCTACGAGCTAG
ACAAAAGCGTAATGAGGAGGAACTCGAAAAAGAGAAAAGAAATCAATTAGAGGAGGAAAGACGTCGTGAGAACCCAGAGT
CTTACTTAGAGGAGTTGCAAGCTCAGTACAAGGAAGTGTTGGAGAGAGTTGAGCAGAAGAAGCGTCTGAAAACAAACGGG
TCCAGTAACGGGAATAACAAGTCTGGAGGTATTGGGCGAGGCGAGCGACTCAGTGCTGCACAGAGGGAGAGAATGCGTCT
GCTGACGACAGCAGCCTTTGATAGAGGGAAAGGCGAGGATACGTTTGGTTCTAGAGATGAAGATTGGCAGCTCTACAAAC
TTATGAGCAAGGATAATGACGATGATGACGAACAACCTGATTCAGACGAGGCAGAGTTGGCTCGTTTATCATCTAGACTT
CAGGAAATTGATCCAACATTTGTGCAGAAAGTAGAAGGAGAATTGAGTCAGACATCAGGGGAGGTGCCACGCGTACGCCC
ATTAACAGAGGAAGACTACAAGATAGTGATTGGTATAGAAAGATTCCGTTGCCCAGAGATCCTGTTCCATCCAAACCTTA
TTGGTATTGACCAAGTAGGCTTAGACGAGATGGCTGGCACATCAATCAGAAGGCTACCGCACGACGAGAAAGAGTTAGAG
GAGAGGCTAACGAGCTCGATACTAATGACGGGCGGGTGTAGCCTTCTTCCAGGGATGAACGAGCGGTTGGAATGTGGGAT
TAGGATGATAAGACCTTGCGGATCACCCATTAACGTGGTTAGAGCTATGGATCCAGTGCTGGATGCATGGCGAGGAGCAT
CTGCATTTGCTGCTAATTTGAACTTCTTGGGGAATGCCTTTACTAAGATGGATTACGACGAGAAAGGTGAAGATTGGCTT
AGAAATTATCAAATTCGATACAACTATTTGTGA