Details for Arabidopsis Locus AT3G12370

Position : Chr3 ( 5`- 3937190 .. 3938094 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12370

Protein [Map View]
MASLRRALLVAGKTKINLENCHFITGINYNGLSVKQLQELRGILRENTNTKLLVAKNTLVYKALEGTKWESLKPCMKGMN
AWLFVQSEDIPAALKTFINFQKEKKLYDNNLGGAVFEEKLYAPQDYKVIETMPSRADVYGMMLGSLHWPALDLVNALQAP
PAASENETVVA*

DNA
ATGGCTAGCCTGAGAAGAGCTCTGCTCGTAGCAGGGAAGACGAAGATCAACCTAGAAAACTGCCATTTCATCACCGGAAT
CAACTACAACGGTCTCAGCGTGAAGCAACTACAAGAGCTCCGTGGAATCCTCCGTGAAAACACAAACACGAAGCTCCTCG
TCGCCAAGAACACTTTAGTCTACAAAGCCTTGGAAGGAACCAAATGGGAGTCTCTGAAGCCATGTATGAAGGGTATGAAC
GCTTGGCTATTCGTTCAATCTGAAGATATACCTGCTGCTTTGAAGACTTTCATCAATTTTCAGAAAGAGAAGAAGCTCTA
CGATAACAATTTAGGCGGTGCTGTTTTTGAGGAGAAATTGTATGCTCCTCAGGATTACAAGGTTATTGAGACGATGCCTT
CTCGCGCTGATGTTTATGGTATGATGCTTGGTTCTTTGCATTGGCCGGCGTTAGATCTCGTCAATGCGTTGCAGGCCCCA
CCGGCGGCGTCGGAAAATGAGACAGTTGTTGCATAG