Details for Arabidopsis Locus AT3G12350

Position : Chr3 ( 5`- 3931555 .. 3933356 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12350

Protein [Map View]
MATFALPFCEIPEDLQLRILSLLTPAEISSFACTSKRFASLCQEDGKIWHVMCDQRWGKKTKIQKWANGQIPYRHLYKTL
KGLENLIGFWRLCGRANPAASSPPLVFFDWGSSFILGSRVLSTGDDTYEVKKTPFLLMGISPEGRSENFLDLVGGNLRSV
DDDLKELEASNNLVSVDVNFMGNGHIMVEENRCFTNNNRREDQRSSGDESDDLISSPNFSEMYTQLANKTSPGGDRRRQK
RKEKERQASRTKWEPEHFLKVADCSPTPTRPLQGLWKGFCEGSIELYLVKYDEVGGIICRKVEDLSLSRYTPPVFWTPKH
TFIRSPFSAEEELLLNSRIHISPFAEVHENVVSGMLYMKSSCDLVLPGEPGNGIGFLRGEGRVWLYDNGTFGFGFLRDQF
IIDLKRVALEDGCLADEVEACM*

DNA
ATGGCTACATTTGCACTTCCCTTCTGCGAAATTCCCGAGGATCTCCAGCTCCGAATCTTATCCCTCCTCACACCAGCGGA
GATCTCCAGCTTCGCCTGCACATCGAAACGCTTCGCCTCGCTATGTCAAGAAGACGGCAAAATCTGGCACGTTATGTGCG
ATCAGAGATGGGGGAAGAAAACTAAGATCCAGAAATGGGCAAACGGTCAAATCCCTTATAGACACCTTTACAAGACTCTA
AAGGGATTGGAGAATCTAATTGGCTTCTGGCGTCTCTGCGGCAGAGCAAATCCCGCCGCTTCATCGCCGCCGCTTGTTTT
CTTCGATTGGGGTTCTTCTTTTATATTGGGATCTAGAGTTTTATCCACCGGAGATGATACTTATGAGGTAAAGAAGACAC
CTTTTCTCTTAATGGGGATTTCGCCGGAGGGACGATCTGAGAATTTCTTGGATCTCGTCGGTGGTAATCTCAGATCTGTG
GATGATGATTTGAAAGAATTAGAAGCTTCTAACAATCTCGTCTCGGTGGATGTGAATTTCATGGGGAATGGTCATATCAT
GGTGGAGGAGAATCGATGTTTTACCAACAACAATCGTAGAGAAGACCAGAGGAGCTCAGGGGATGAGAGTGATGATTTGA
TCTCATCGCCCAATTTTTCGGAAATGTACACTCAATTGGCGAATAAGACGAGTCCAGGCGGTGACAGGAGGAGACAGAAG
AGGAAGGAGAAGGAGAGGCAAGCGTCGAGGACTAAGTGGGAACCAGAACACTTTCTCAAAGTTGCTGATTGCTCCCCCAC
GCCTACTAGACCCTTACAAGGCTTATGGAAGGGTTTCTGTGAGGGAAGCATCGAGTTGTATTTGGTCAAATATGATGAAG
TTGGAGGCATTATATGCAGAAAAGTAGAGGACTTGTCCCTCTCACGGTACACTCCTCCTGTGTTCTGGACACCCAAACAT
ACGTTCATCAGATCTCCTTTTTCAGCTGAAGAAGAGCTGCTACTGAATAGTCGAATCCATATTAGCCCTTTCGCTGAAGT
TCATGAAAATGTTGTATCTGGAATGTTGTACATGAAGTCTAGCTGCGATCTGGTGTTGCCAGGAGAACCTGGCAATGGCA
TTGGTTTTCTTAGAGGTGAAGGGCGGGTCTGGTTGTATGACAATGGGACTTTCGGTTTCGGGTTTCTTCGAGATCAATTT
ATCATTGATCTGAAACGTGTTGCTCTGGAAGATGGGTGTCTAGCTGACGAGGTAGAAGCTTGTATGTGA