Details for Arabidopsis Locus AT3G12345

Position : Chr3 ( 5`- 3930180 .. 3930992 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12345

Protein [Map View]
MAITPLRITNPFPSLRFIPAGKPNALRIFTVHATDVESTEDTQPDPETTQSESGTDPDQFESRLSNIRLRYRSGTGKKAE
VRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGLKVEPGFSPFSERINGRIAGLGLTALLLVELATGKSVLNYHTPSVVFL
QIYFVAAVSAMFVKIEKEKVSVWPKD*

DNA
ATGGCGATAACACCTCTGCGAATCACGAACCCATTCCCATCTCTCCGCTTTATTCCCGCCGGAAAGCCCAATGCTTTAAG
AATCTTCACCGTCCACGCTACCGACGTTGAGTCCACGGAGGATACTCAACCCGACCCGGAAACTACACAGTCCGAATCCG
GCACTGATCCGGACCAATTCGAGTCTCGTCTCTCAAACATCAGACTCAGATACCGAAGCGGGACGGGTAAGAAAGCAGAA
GTGAGAAAATCGAAGAAAGGGTCAAGTGGGTCTCCGTCGAAAGGTACGGGAATATATTTGCCGCCGGTAAGCTTAAAAGA
AGCGGTTTCAGGTGGTTTGAAAGTGGAACCAGGGTTTAGTCCCTTCAGCGAAAGGATTAATGGAAGGATTGCGGGATTAG
GGCTCACGGCTTTGCTTCTAGTTGAGCTTGCGACGGGTAAGAGTGTGTTGAATTACCACACGCCTTCTGTGGTGTTTCTT
CAGATCTATTTCGTTGCGGCTGTTTCTGCTATGTTTGTCAAGATTGAGAAGGAGAAGGTTAGTGTTTGGCCTAAGGATTA
A