Details for Arabidopsis Locus AT3G12340

Position : Chr3 ( 5`- 3925526 .. 3929405 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12340

Protein [Map View]
MAFWGVEVKPGKTFTLKNNEATGIRRLHLSQATLGHGTATNRSILQCNVGNKSPLLLCVLTPDKVDSCQLNLEFEETDEV
IFSVIGPRSVHLTGYFLGRSTGFRPNDDESESFGEDIVDTDMEKGSSDDYDYSDSFINDDDPAVRGSHVSSTDDDEISIK
EMTAKTKEKKKNGKGRRLRKKFQVSDSDSDETSARADESSNEDSVEVLNNGNEPKIAKVHSSESPLPSRVTRSKARKSTL
ESGEPAKCEKTFEAKINTHKTLDNREDKPLDDAKLSPVQKDCEILSKKKRNKERSKSSAIIIDSDDGEGKNMPESLQNEN
PVSDKGIKSSSDVLLSQNGDATLSKKKKKRDRREETTDVPECPEKKKQAIDKNIEKEAGTKKPLETRTLSNGVIIEDIEK
GKLDGKSAVKGKKVSILYTGKLKDTGNLFDSNLGEDPLRFRLGGENVIEGLSIGVEGMRVGDKRRLIIPPALGYSKRGLK
EKVPKSAWLVYEVEAVKIR*

DNA
ATGGCTTTTTGGGGAGTTGAAGTGAAGCCAGGCAAAACTTTCACTCTTAAGAATAATGAAGCTACAGGAATCAGAAGACT
TCACCTTTCCCAGGCAACATTGGGCCATGGTACTGCAACCAATAGAAGCATTCTACAGTGTAACGTTGGGAACAAAAGTC
CCCTCTTGTTATGTGTCTTGACTCCTGATAAAGTTGATTCTTGCCAATTGAATCTGGAGTTTGAAGAAACTGATGAGGTT
ATCTTCTCTGTCATCGGACCTCGGAGTGTACACCTCACTGGCTACTTCCTCGGAAGGAGTACCGGGTTTAGGCCAAATGA
TGATGAATCAGAGTCATTTGGAGAAGACATTGTTGACACAGACATGGAGAAAGGTAGCAGTGATGATTATGACTACAGTG
ATAGTTTCATTAACGACGACGATCCAGCTGTCCGTGGTTCACACGTGTCTAGTACTGATGATGATGAAATATCTATTAAG
GAGATGACAGCTAAAACAAAAGAGAAGAAAAAAAATGGAAAAGGTAGAAGACTAAGGAAGAAGTTTCAAGTTTCTGATTC
AGATTCTGATGAAACTTCGGCTAGAGCTGATGAATCTAGCAATGAGGATTCTGTAGAAGTACTTAACAATGGTAATGAGC
CCAAGATCGCGAAGGTCCATTCTTCAGAGAGTCCTCTGCCTTCAAGGGTTACGAGGTCGAAGGCAAGAAAATCGACTTTG
GAAAGTGGTGAGCCTGCCAAGTGTGAGAAGACATTTGAAGCAAAAATTAATACTCACAAGACTCTGGATAATAGGGAGGA
TAAACCATTGGATGATGCTAAACTGTCTCCCGTCCAGAAAGACTGTGAAATTCTTTCGAAGAAAAAAAGAAACAAGGAAA
GGTCTAAGAGTTCAGCTATAATTATTGACTCAGATGACGGAGAGGGGAAAAATATGCCTGAAAGTCTTCAGAATGAGAAT
CCAGTTTCTGACAAGGGGATCAAATCATCAAGTGATGTATTACTTTCTCAGAATGGTGATGCAACTCTATCAAAGAAAAA
GAAGAAAAGGGATAGGAGAGAGGAAACTACAGATGTCCCGGAATGTCCAGAGAAGAAGAAACAAGCTATCGACAAGAACA
TCGAGAAAGAAGCTGGTACTAAGAAACCACTAGAAACGAGGACTTTATCAAATGGAGTGATCATTGAAGATATTGAAAAA
GGAAAGTTAGATGGAAAATCAGCTGTTAAAGGGAAAAAGGTCAGTATACTCTATACTGGGAAGTTGAAAGACACCGGGAA
CTTGTTTGATTCAAACTTGGGAGAAGATCCACTAAGATTCCGCTTAGGTGGAGAAAATGTCATAGAAGGTCTCAGCATTG
GTGTTGAAGGAATGCGAGTTGGTGATAAGAGAAGACTCATAATACCGCCAGCCCTCGGGTACTCAAAAAGGGGATTGAAG
GAAAAGGTGCCTAAGAGTGCGTGGCTTGTCTATGAAGTGGAGGCTGTAAAAATCAGATAA