Details for Arabidopsis Locus AT3G12320

Position : Chr3 ( 5`- 3923735 .. 3925465 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12320

Protein [Map View]
MDCYAEELVVPNYQESSSETYPSTGMWGGWSMSSPEAAEKCFDYDGFNGEGMMYSQMSMRTSEEEEESKRSKAFYGASSL
HDFEGIEQMDDMFLSSILEDVPEDDGDVHRATSSNNSVGSSSMYGGGREVPMFHCHDMSFKEEAPFTISDLSEENMLDSN
YGDELSSEEFVLQDLQRASQKLTDETRKCFRDTFYRLARSSQDKSDSVSPNSEELLMQTSRYDYGDGNRFSREEEIESET
NSIDRAVANLTFNKMESNISNFPLSERVQ*

DNA
ATGGATTGTTATGCTGAAGAGCTTGTTGTGCCTAATTATCAAGAATCATCATCAGAGACATACCCATCTACTGGTATGTG
GGGTGGATGGAGCATGAGCTCCCCTGAAGCAGCTGAGAAATGTTTCGATTACGATGGTTTCAATGGAGAAGGAATGATGT
ATAGTCAGATGAGTATGAGGACTAGTGAAGAAGAAGAAGAGTCTAAAAGATCAAAGGCTTTCTATGGTGCTTCTTCACTT
CACGATTTCGAAGGCATCGAACAGATGGATGATATGTTCTTAAGTTCAATTTTGGAGGATGTTCCAGAGGATGATGGAGA
TGTTCACCGCGCGACCAGTAGCAATAACAGTGTCGGTTCTTCTTCTATGTATGGTGGTGGTAGGGAAGTCCCTATGTTCC
ATTGTCATGACATGTCTTTCAAGGAGGAAGCTCCATTTACAATCTCGGATCTGTCTGAAGAGAACATGTTAGATTCAAAC
TATGGGGATGAACTGTCTTCTGAAGAATTCGTGTTGCAGGATCTACAAAGGGCTTCACAAAAGTTGACTGATGAGACACG
CAAATGTTTCCGGGATACTTTTTACCGACTTGCAAGGAGCTCACAAGATAAATCTGATTCAGTCAGCCCCAACTCGGAAG
AGCTGCTTATGCAAACGTCTAGATATGATTATGGTGATGGAAACAGGTTTAGTAGAGAGGAAGAGATAGAATCTGAAACG
AATTCAATCGATAGAGCTGTCGCAAACCTCACATTCAACAAAATGGAATCCAACATAAGCAATTTTCCTCTGTCGGAAAG
AGTACAGTAG