Details for Arabidopsis Locus AT3G12280

Position : Chr3 ( 5`- 3913412 .. 3919170 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12280

Protein [Map View]
MEEVQPPVTPPIEPNGKRSEASLLDICEKVLSLDGSTCDEALKLFTETKRILSASMSNIGSGTREEVERFWFAFILYSVK
RLSVRKEADGLSVSGDNEFNLCQILRALKLNIVDFFKELPQFVVKAGSVLGELYGADWENRLQAKEVQANFVHLSLLSKY
YKRGFREFFLTYDANAEKNSANSSTYLLDSYRFGWLLFLALRNHAFSRFKDLVTCSNGVVSILAILIIHVPCRFRNFSIQ
DSSRFVKKGDKGVDLVASLCKIYDASEDELRIVIDKANNLVETILKKKPSPASECQTDKLDNIDPDGLTYFEDLLEETSI
STSLITLEKDYYDGKGELDERVFINEEDSLLGSGSLSAGAVNITGVKRKIDALSSPARTFISPLSPHKSPAAKTNGISGA
TKLAATPVSTAMTTAKWLRTVISPLLPKPSPGLEHFLKSCDRDITNDVTRRAHIILEAIFPNSSLGAQCGGGSLQAVDLM
DDIWAEQRRLEACKLYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVLATHKTITMLFPAVLERTGITAF
DLSKVIESFIRHEDSLPRELRRHLNSLEERLLESMVWEKGSSMYNSLIVARPSLALEINQLGLLAEPMPSLDAIAALINF
SDGANHASSVQKHETCPGQNGGIRSPKRLCTDYRSILVERNSFTSPVKDRLLALGNVKSKMLPPPLQSAFASPTRPNPGG
GGETCAETGINIFFTKINKLAAVRINGMVERLQLSQQIRESVYCFFQHVLAQRTSLLFSRHIDQIILCCFYGVAKISQMS
LTFREIIYNYRKQPQCKPLVFRSVYVDALQCRRQGRIGPDHVDIITFYNEIFIPAVKPLLVELGPVRNDRAVEANNKPEG
QCPGSPKVSVFPSVPDMSPKKVSAVHNVYVSPLRGSKMDALISHSTKSYYACVGESTHAYQSPSKDLSAINNRLNNSSSN
RKRTLNFDAEAGMVSDSMVANSLNLQNQNQNQNGSDASSSGGAAPLKTEPTDS*

DNA
ATGGAAGAAGTTCAGCCTCCAGTGACCCCGCCCATTGAACCAAATGGGAAAAGAAGCGAAGCCTCTCTCTTGGACATATG
CGAGAAAGTTCTGTCTCTTGATGGGAGCACTTGCGATGAAGCTTTGAAGTTGTTTACAGAAACCAAACGAATTTTGTCAG
CAAGCATGTCTAACATTGGAAGTGGAACGCGGGAAGAAGTAGAGAGGTTCTGGTTTGCGTTTATTCTCTATTCAGTGAAG
AGGCTTAGTGTGAGAAAAGAAGCGGATGGTCTGTCAGTGTCTGGTGATAATGAGTTTAATCTATGTCAGATACTGAGGGC
TCTGAAGCTAAATATTGTGGATTTTTTTAAAGAGTTACCTCAGTTTGTGGTCAAGGCTGGATCTGTACTGGGTGAACTTT
ACGGCGCAGACTGGGAGAACAGACTTCAGGCAAAGGAGGTGCAGGCTAACTTTGTGCATCTTAGCCTTCTAAGCAAATAC
TACAAACGTGGGTTCCGGGAATTCTTTTTGACATATGATGCAAACGCAGAAAAGAACTCAGCAAACTCTTCTACCTATTT
GCTGGATAGTTATCGTTTTGGATGGCTACTCTTTTTGGCACTCCGAAACCATGCGTTTAGTCGATTTAAGGACCTCGTGA
CATGCTCAAATGGCGTAGTTTCTATATTGGCTATTTTGATCATACATGTTCCTTGTCGGTTTAGAAATTTCAGCATCCAA
GATTCTTCTCGCTTTGTTAAGAAAGGTGACAAAGGTGTAGACTTGGTTGCATCACTTTGCAAGATATATGACGCCTCAGA
AGATGAGTTGAGGATAGTAATTGACAAGGCAAATAATTTGGTAGAAACCATACTGAAGAAAAAGCCATCTCCAGCATCTG
AGTGCCAAACTGACAAGCTAGATAATATTGACCCAGATGGCTTGACCTACTTTGAGGATTTACTGGAAGAGACGTCCATC
TCAACTAGCTTAATTACACTTGAAAAGGATTACTATGATGGTAAAGGCGAACTTGATGAGAGGGTATTCATCAATGAAGA
GGATAGCTTACTTGGATCTGGAAGCTTATCTGCAGGAGCTGTTAATATTACTGGTGTTAAGAGGAAAATTGATGCTTTGA
GCTCACCTGCAAGGACATTTATAAGCCCACTTTCTCCTCATAAGTCGCCTGCTGCTAAGACAAATGGTATTAGCGGTGCT
ACCAAGTTGGCAGCAACACCAGTGAGCACAGCAATGACAACTGCCAAGTGGCTCAGGACTGTCATATCCCCGCTTCTGCC
AAAACCTTCTCCTGGGTTGGAACATTTCCTTAAATCATGTGATAGGGATATAACAAATGACGTCACACGAAGAGCACACA
TAATATTGGAAGCTATTTTCCCAAATAGTTCCCTTGGTGCCCAATGTGGAGGTGGAAGTTTGCAAGCTGTTGACCTGATG
GATGACATATGGGCAGAGCAGCGCAGATTAGAAGCTTGTAAGTTATACTACAGAGTTCTTGAGGCAATGTGTAAAGCAGA
AGCTCAGATTTTGCATGCAAATAATCTGAACTCTTTATTGACAAATGAGAGGTTCCATAGATGCATGCTTGCTTGCTCAG
CTGAATTGGTACTGGCTACCCACAAAACAATTACAATGTTGTTCCCAGCTGTTCTGGAGAGGACTGGGATCACAGCCTTT
GATCTCAGCAAGGTAATTGAGAGTTTCATACGACATGAAGATTCTCTGCCTAGAGAGTTGAGACGACATCTGAATTCACT
GGAGGAACGGCTTCTAGAGAGTATGGTATGGGAGAAAGGCTCTTCAATGTACAATTCTCTGATTGTTGCCAGGCCATCGC
TTGCATTGGAGATAAATCAGCTCGGTTTACTAGCTGAACCAATGCCATCTCTGGATGCAATCGCAGCACTTATTAATTTC
TCTGACGGAGCAAATCATGCATCATCTGTACAAAAGCATGAAACTTGTCCAGGACAAAATGGGGGGATTAGATCGCCCAA
AAGATTATGTACTGATTACCGCAGCATTCTAGTTGAACGCAATTCCTTTACATCACCAGTAAAGGATCGTCTGTTGGCCT
TAGGCAACGTTAAATCCAAGATGCTGCCACCTCCGTTGCAGTCTGCATTTGCCAGCCCAACACGGCCCAACCCAGGAGGT
GGAGGAGAAACTTGTGCAGAAACTGGAATCAATATTTTCTTCACAAAGATTAATAAATTGGCTGCTGTAAGAATCAATGG
AATGGTGGAAAGACTACAACTTTCACAGCAAATAAGGGAGAGTGTGTATTGTTTCTTCCAACATGTACTTGCTCAGCGGA
CTTCTCTTTTATTCAGTCGACACATTGACCAGATCATTCTCTGTTGCTTCTACGGAGTGGCCAAGATATCCCAAATGAGC
CTGACTTTCAGGGAAATCATATACAACTACCGGAAGCAACCACAGTGTAAACCATTAGTTTTCCGCAGCGTTTATGTGGA
TGCGTTACAATGTCGCCGTCAAGGGAGAATAGGGCCAGATCATGTTGACATCATCACATTCTACAATGAAATATTTATTC
CTGCCGTAAAGCCGCTGCTGGTGGAGCTAGGTCCTGTAAGAAACGACCGGGCTGTGGAAGCCAATAATAAGCCTGAAGGT
CAATGTCCCGGATCGCCAAAGGTGTCTGTGTTTCCAAGTGTTCCAGACATGTCCCCTAAAAAAGTATCTGCAGTGCACAA
TGTTTATGTTTCTCCTCTTCGGGGATCAAAGATGGATGCTCTTATTTCACACAGTACAAAGAGTTACTATGCTTGTGTTG
GAGAGAGTACACATGCTTACCAGAGCCCTTCAAAGGACCTATCTGCCATCAACAACCGCTTGAACAACAGCAGCAGCAAC
CGCAAGAGGACGCTAAACTTTGACGCAGAAGCAGGGATGGTCAGCGATTCCATGGTAGCAAATAGCCTTAACCTCCAAAA
CCAAAATCAAAACCAAAATGGAAGCGATGCATCGTCCTCAGGTGGTGCCGCACCCCTTAAAACCGAGCCAACAGATTCAT
AG