Details for Arabidopsis Locus AT3G12250

Position : Chr3 ( 5`- 3905514 .. 3908983 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12250

Protein [Map View]
MADTSSRTDVSTDGDTDHRDLGFYYLYNVTPGRLVPESLGKTWGILPSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNR
EAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSA
LNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVM
GINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQML
RVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE*

DNA
ATGGCTGATACCAGTTCAAGGACTGATGTCTCAACTGATGGTGACACAGATCATAGAGATCTGGGGTTTTATTATCTCTA
CAATGTCACTCCTGGGAGGCTTGTACCGGAATCCCTTGGTAAAACTTGGGGCATTCTACCGTCTGATAGAGGGCATATGC
ATGCTGCTGCCTCTGATTCCAGTGATCGATCAAAGGATAAGTTGGATCAAAAGACCCTTCGTAGGCTTGCTCAAAATCGT
GAGGCAGCAAGAAAAAGCAGATTGAGGAAGAAGGCGTATGTTCAGCAGCTGGAGAATAGTCGATTAAAGCTGACTCAACT
TGAGCAGGAGCTGCAAAGAGCAAGACAGCAGGGAGTTTTCATCTCAAGTTCAGGAGACCAAGCTCATTCTACTGGTGGCA
ATGGGGCTTTGGCATTTGATGCAGAACACTCACGATGGCTTGAAGAAAAGAACAGGCAAATGAACGAGCTGAGATCTGCC
CTGAATGCTCATGCAGGTGATACTGAGCTCCGGATAATTGTGGATGGAGTGATGGCTCACTATGAGGAGCTTTTCAGGAT
TAAGAGCAATGCAGCTAAGAATGATGTCTTCCACTTGTTATCTGGAATGTGGAAAACACCAGCTGAGCGATGTTTCTTGT
GGCTTGGCGGGTTCCGCTCATCCGAACTTCTCAAGCTTCTTGCGAATCAGCTAGAGCCCATGACAGAACGACAGGTAATG
GGCATCAATAGCTTGCAGCAGACGTCGCAGCAGGCAGAAGATGCTTTATCTCAAGGGATGGAGAGTTTACAGCAATCCCT
AGCTGATACTTTATCCAGTGGAACTCTTGGTTCCAGTTCATCGGATAATGTCGCGAGCTACATGGGTCAGATGGCCATGG
CAATGGGGCAGTTAGGCACCCTCGAAGGATTCATACGCCAGGCTGATAACTTGAGGCTGCAAACACTACAACAGATGCTT
CGAGTATTAACAACACGTCAGTCAGCTCGTGCTCTTCTTGCTATACACGATTATTCATCTCGATTACGTGCTCTTAGTTC
CTTGTGGCTTGCCCGGCCAAGAGAGTGA