Details for Arabidopsis Locus AT3G12203

Position : Chr3 ( 5`- 3891357 .. 3893981 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12203

Protein [Map View]
MGKECYYLSWILKFHLLLVLIQLVDSGSTIRFLPGFQGPLPFELETGYIGVGEAEKDQMFYYFIKSESNPEKDPLLLWLS
GGPFCSSFTALIYENGPIAFKAEEYNGSIPSLVSTTYAWTKVASILYLDQPVGTGFSYSRNPLADIPSDTGVAKPVNEFL
HKWLDKHPEFLSNPLYVAGNSYSGIVIPTIVQEISNGNHLDSKPQINLQGFVLGNPATDTDIDLNSRIPFAHGKALISDE
HYESLKRSCQGNYISVNPRNTKCLKLLEDFKKCVSGISEEYILKPDCMWLYSCMANLHSLSEYWANEKSVRKALLVNEGT
VRKWIRCNTEIAYNKDIRSSVPYHKYISIEGYRSLVFSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRT
YANKMTFATVKGGGHTSEYKPVETYIMIKRWLSGQPL*

DNA
ATGGGGAAAGAGTGCTACTACTTGTCATGGATACTCAAGTTTCATCTTCTACTTGTTTTGATTCAGCTTGTTGATTCAGG
ATCTACCATCAGATTTCTTCCTGGTTTCCAAGGCCCTCTTCCTTTCGAGCTCGAGACCGGGTACATTGGTGTGGGTGAGG
CAGAGAAAGATCAAATGTTCTACTACTTCATCAAATCTGAGAGTAATCCAGAGAAAGACCCTCTTCTTCTCTGGTTAAGT
GGAGGTCCTTTCTGTTCTTCGTTCACTGCTCTTATTTATGAGAATGGGCCAATTGCTTTCAAGGCTGAGGAATACAATGG
AAGTATCCCCTCTTTGGTCTCTACCACATATGCATGGACTAAGGTGGCGAGCATTCTCTATTTGGATCAGCCTGTTGGGA
CTGGCTTCTCCTACTCCAGAAATCCACTTGCTGATATACCAAGTGACACAGGGGTAGCTAAGCCGGTCAACGAGTTTCTT
CATAAGTGGCTAGACAAACATCCTGAGTTCTTATCCAATCCGCTCTATGTCGCCGGAAATTCTTATTCCGGTATTGTCAT
TCCGACCATCGTTCAAGAAATCTCAAATGGAAACCATTTAGACAGCAAACCTCAAATAAATCTTCAGGGCTTTGTACTCG
GAAACCCGGCAACAGACACTGATATTGATCTTAACTCTCGCATTCCATTTGCTCATGGAAAGGCACTGATCTCTGATGAA
CACTATGAGTCTCTAAAGAGAAGTTGTCAAGGGAATTATATTAGCGTGAATCCTCGTAACACAAAATGCTTGAAACTCCT
TGAAGACTTTAAAAAGTGTGTTTCTGGAATAAGTGAAGAATATATTCTAAAACCTGACTGCATGTGGCTTTATTCTTGTA
TGGCAAATCTGCATTCGCTATCTGAATATTGGGCAAATGAGAAAAGCGTGCGCAAAGCTCTTCTAGTGAACGAGGGTACC
GTAAGAAAATGGATACGATGTAATACGGAAATCGCATACAATAAGGACATTAGGAGTAGTGTGCCATATCATAAGTATAT
TAGCATTGAAGGGTATCGATCTCTCGTCTTCAGTGGTGATCACGACATGTTAGTACCTTTCCTTGGAACTCAAGCATGGA
TAAGATCTCTCAACTATTCCATTGTTGACGATTGGAGACCATGGATGGTTCAGAATCAAGTTGCTGGATACACAAGGACT
TATGCGAATAAGATGACATTTGCCACTGTCAAAGGAGGCGGGCACACGAGTGAGTATAAACCAGTGGAGACCTATATCAT
GATCAAGAGGTGGTTAAGTGGTCAACCTCTATAA