Details for Arabidopsis Locus AT3G12170

Position : Chr3 ( 5`- 3881000 .. 3882804 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12170

Protein [Map View]
MENDGRSNEKNLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEKRAVYDQTGSVDD
ADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGSESEKNDLIELYNKFKGKMSRLFCSMLCSNPKLDSHRFKDIIDE
AIAAGEVKSTKAYKKWAKEIAEMEPPTNPQKMRRKAAKAADKDLYAVMSQRGDERKEKFDSMFSSLVSRYGSNADSEPNE
EEFEAAQRKVESRRSSKKSRKK*

DNA
ATGGAGAATGATGGAAGATCCAATGAGAAAAATCTGTACGAGGTTCTTGGTGTTGAAGCAACAGCATCTCCACAAGAGAT
AAGGAAAGCGTATCATAAGTTAGCATTGAGGCTTCATCCTGATAAAAACAAGGATGATGAGGATGCTAAAGAGAAATTTC
AGCAGTTGCAAAAGGTTATTTCGATTCTCGGTGATGAAGAGAAAAGAGCAGTCTATGATCAAACTGGCTCAGTTGATGAT
GCTGATCTTTCGGGAGATGTGGTTGACAACTTGAGGGACTTCTTCAAGGCAATGTACAAGAAGGTCACCGAGGAAGATAT
TGAAGAGTTTGAGGCCAACTATAGGGGTTCTGAATCCGAGAAGAATGATTTGATTGAGCTATATAACAAGTTTAAGGGTA
AAATGAGCAGGCTTTTCTGCTCAATGCTTTGCTCGAACCCCAAGCTTGATTCGCACCGTTTCAAAGATATTATCGATGAG
GCCATTGCAGCGGGAGAAGTGAAATCAACAAAAGCTTACAAGAAATGGGCAAAGGAGATTGCAGAAATGGAACCTCCCAC
GAATCCCCAGAAGATGAGACGGAAAGCAGCAAAGGCTGCAGATAAAGATTTATACGCTGTAATGTCCCAGCGGGGAGATG
AGAGGAAAGAGAAGTTCGATTCAATGTTCTCTTCACTTGTCTCTAGGTATGGTAGCAATGCTGACTCTGAGCCAAACGAA
GAAGAGTTCGAAGCTGCTCAGAGAAAAGTTGAAAGCCGGAGATCATCGAAGAAGTCTAGAAAAAAATAA