Details for Arabidopsis Locus AT3G12145

Position : Chr3 ( 5`- 3874499 .. 3876237 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12145

Protein [Map View]
MKLFVHLSIFFSILFITLPSSYSCTENDKNALLQIKKALGNPPLLSSWNPRTDCCTGWTGVECTNRRVTGLSVTSGEVSG
QISYQIGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLS
QMPKLEAIQINDNKLTGSIPNSFGSFVGNVPNLYLSNNKLSGKIPESLSKYDFNAVDLSGNGFEGDAFMFFGRNKTTVRV
DLSRNMFNFDLVKVKFARSIVSLDLSQNHIYGKIPPALTKLHLEHFNVSDNHLCGKIPSGGLLQTFEPSAFAHNICLCGT
PLKAC*

DNA
ATGAAGCTCTTTGTTCATCTCTCTATCTTCTTCTCCATCCTCTTCATCACTCTCCCATCTTCTTACAGCTGCACCGAAAA
TGACAAGAATGCCCTCCTTCAAATCAAGAAAGCACTTGGCAATCCTCCCCTTCTATCCTCCTGGAACCCCCGAACCGACT
GTTGTACCGGCTGGACCGGCGTCGAATGCACTAACCGTCGCGTTACCGGTCTCAGCGTTACCTCCGGCGAAGTCTCCGGT
CAGATCTCGTACCAGATCGGCGACCTCGTTGACCTCCGTACACTAGATTTCAGCTACCTGCCACACCTCACCGGAAACAT
CCCACGCACCATCACCAAACTCAAGAACCTCAACACTCTCTACTTGAAGCACACTAGTCTCTCCGGTCCGATTCCTGATT
ACATCAGCGAGCTCAAGAGCCTCACGTTCTTGGACCTTTCTTTTAACCAATTTACCGGTCCAATTCCCGGTTCGCTATCT
CAGATGCCGAAGCTTGAAGCCATTCAAATCAACGATAATAAGCTAACCGGTTCTATACCAAACTCTTTCGGTTCTTTTGT
TGGCAACGTCCCTAATCTCTACTTGTCTAACAATAAGCTGTCAGGAAAAATACCGGAATCGTTGTCTAAATACGACTTCA
ACGCAGTGGATTTGTCGGGAAATGGTTTCGAAGGAGATGCCTTTATGTTCTTCGGACGGAACAAAACAACAGTACGAGTG
GATTTGTCGAGAAACATGTTTAATTTCGATCTCGTCAAGGTTAAGTTCGCTAGAAGCATAGTTTCGTTGGATCTGAGCCA
GAACCATATCTACGGGAAGATACCACCAGCACTGACTAAACTACACCTCGAGCATTTCAACGTGAGCGACAACCATCTCT
GCGGAAAAATCCCAAGTGGCGGTCTACTTCAGACCTTTGAACCATCTGCCTTCGCTCACAACATCTGTCTTTGTGGAACT
CCCCTTAAGGCTTGTTAA