Details for Arabidopsis Locus AT3G12140

Position : Chr3 ( 5`- 3868588 .. 3871728 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12140

Protein [Map View]
METQIHQLEQEAYTAVLRAFKAQSDAISWEKESLITELRKELRVSDDEHRELLSRVNKDDTIQRIRDWRQGGASQITRHA
TIQPFDVLPSPTFSAARKKQKTFPSYNPSIGATGNRSFNNRLVSSGISGNESAEALIGRKVWTKWPEDNHFYEAIITQYN
ADEGRHALVYDIHAANETWEWVDLKEIPPEDIRWDGEESGVALNIGHGSASFRGNRRGQIHGGRGRGPRIHQPRRELVPP
PTQQNGSGGRRTSSDDIELFNTDSLVKEVERVFDSTHPDPLELDKAKKMLKEHEQALIAAIARLADTSDGEMGNNNKSTL
RLVCNLRIIYYLPLNFCVMMIISSIITNLILGKIIRELIHTCSACDFSVTCKQLNSLKYRSSS*

DNA
ATGGAGACACAAATTCATCAACTTGAGCAGGAAGCATATACCGCTGTTTTAAGGGCTTTTAAAGCGCAGTCTGATGCGAT
TTCTTGGGAAAAAGAAAGCTTGATAACCGAATTGCGTAAAGAATTGAGAGTATCTGATGATGAACATCGAGAGCTTCTCA
GTAGGGTCAATAAGGATGATACTATCCAGAGGATAAGAGATTGGAGACAGGGAGGCGCAAGCCAAATTACTAGACATGCA
ACTATTCAGCCTTTTGATGTTCTTCCTAGTCCCACTTTCTCAGCTGCCCGAAAGAAACAGAAAACATTTCCATCTTATAA
TCCATCAATTGGTGCGACTGGAAATAGGTCATTCAATAATCGTCTGGTATCCAGTGGCATATCAGGAAATGAATCTGCTG
AAGCTCTGATCGGAAGAAAAGTGTGGACAAAATGGCCTGAAGATAACCACTTCTATGAAGCAATTATAACCCAGTACAAT
GCAGATGAGGGTCGGCATGCTTTGGTGTATGATATACACGCAGCTAATGAAACGTGGGAATGGGTTGATCTCAAGGAGAT
ACCACCGGAAGACATAAGATGGGATGGGGAGGAGAGTGGGGTAGCTTTAAACATTGGACATGGAAGTGCATCCTTCCGTG
GCAACAGAAGAGGCCAAATCCATGGTGGTAGAGGGAGAGGACCAAGAATTCATCAACCAAGAAGGGAACTTGTACCGCCA
CCAACACAACAGAATGGTAGTGGTGGGCGGAGAACTTCCTCTGATGATATTGAGTTGTTCAACACAGACTCGCTTGTGAA
GGAGGTGGAGAGAGTTTTCGATTCTACGCATCCTGATCCACTCGAGCTCGACAAGGCCAAGAAAATGCTCAAGGAACATG
AACAGGCACTCATTGCTGCCATTGCAAGGCTTGCTGATACTTCGGATGGCGAAATGGGTAATAATAACAAAAGCACGCTA
CGTTTAGTTTGCAACCTCAGAATAATATATTATTTACCATTGAATTTTTGTGTTATGATGATAATATCAAGCATAATTAC
AAACTTAATCCTAGGAAAAATAATAAGAGAGTTAATACACACTTGCTCAGCTTGTGATTTCAGCGTAACTTGTAAACAGT
TGAATAGCTTGAAATATAGGTCTTCTTCTTAA