Details for Arabidopsis Locus AT3G12130

Position : Chr3 ( 5`- 3864152 .. 3866596 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12130

Protein [Map View]
MDTRKRGRPEAGSFNSNGGGYKKSKQEMESYSTGLGSKSKPCTKFFSTSGCPFGENCHFLHYVPGGYNAVSQMTNMGPPI
PQVSRNMQGSGNGGRFSGRGESGPGHVSNFGDSATARFSVDASLAGAIIGKGGVSSKQICRQTGVKLSIQDHERDPNLKN
IVLEGTLEQISEASAMVKDLIGRLNSAAKKPPGGGLGGGGGMGSEGKPHPGSNFKTKICERFSKGNCTFGDRCHFAHGEA
ELRKSGIV*

DNA
ATGGATACTCGTAAGAGAGGACGGCCTGAAGCTGGCTCATTCAACTCCAATGGCGGCGGATACAAGAAGTCTAAGCAAGA
GATGGAATCATATTCAACTGGTTTAGGAAGCAAATCGAAGCCATGCACAAAATTTTTCAGTACTTCTGGCTGTCCTTTCG
GAGAGAATTGCCATTTCTTGCATTATGTTCCCGGAGGATACAATGCTGTATCGCAGATGACAAATATGGGACCACCCATT
CCTCAAGTTTCCAGAAACATGCAAGGTTCTGGTAATGGAGGCCGATTCTCAGGGAGGGGAGAGTCTGGGCCTGGCCATGT
CTCTAACTTTGGTGACTCAGCCACTGCCAGATTCAGTGTTGATGCCTCTTTAGCCGGTGCAATCATTGGGAAAGGCGGAG
TCAGTTCAAAGCAGATATGTCGTCAGACGGGAGTAAAATTATCAATTCAAGATCACGAGAGAGACCCAAACTTGAAGAAC
ATTGTGCTTGAAGGAACACTTGAGCAGATAAGCGAAGCGAGTGCAATGGTAAAAGATTTGATTGGGAGGCTTAATTCAGC
AGCTAAGAAACCACCTGGTGGTGGTCTTGGTGGTGGTGGTGGCATGGGTTCTGAAGGGAAACCACATCCAGGGAGCAACT
TCAAGACTAAGATATGTGAGAGATTCTCAAAAGGAAACTGTACATTTGGTGATAGATGTCACTTTGCTCATGGGGAAGCA
GAGCTACGCAAGTCAGGAATCGTCTAG