Details for Arabidopsis Locus AT3G12090

Position : Chr3 ( 5`- 3852145 .. 3853720 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12090

Protein [Map View]
MYRFSNTVIGVLNLLTLLASIPIIGTALYKARSSTTCENFLQTPLLVIGFIILIVSLAGFIGACFNVAWALWVYLVVMIF
LIATLMGLTLFGLVVTSQGGGVEVPGRIYKEYRLGDYHPWLRERVRDPEYWNSIRSCILSSKTCTKIESWTTLDYFQRDM
TSVQSGCCKPPTACTYEAGVVDGGGDCFRWNNGVEMLCYECDACKAGVLEEIRLDWRKLSVVNILVLVLLIAVYAAGCCA
FHNTRHAAHPYHPSDDNRMTRVRPRWDYYWWRWWHEKKEQLY*

DNA
ATGTACAGATTCAGCAACACAGTTATTGGGGTCTTAAACCTTCTCACCTTACTAGCCTCGATTCCAATCATCGGAACCGC
TTTATACAAGGCAAGAAGCAGCACGACATGTGAAAACTTCCTCCAGACGCCGCTACTTGTTATAGGATTCATCATACTCA
TAGTTTCCCTTGCGGGATTCATAGGAGCCTGCTTCAACGTGGCATGGGCTCTTTGGGTGTACTTAGTGGTCATGATCTTC
CTCATCGCTACCCTAATGGGTCTAACGCTATTTGGTCTGGTGGTGACGAGCCAAGGAGGTGGAGTGGAAGTGCCAGGGAG
GATTTATAAAGAGTATAGGCTTGGAGACTATCATCCATGGTTGAGAGAGAGAGTTAGGGATCCTGAGTATTGGAACTCCA
TTAGAAGCTGTATCTTGAGTTCCAAGACTTGTACTAAGATTGAGTCTTGGACTACACTTGATTATTTCCAAAGAGACATG
ACTTCTGTTCAGTCGGGATGTTGTAAGCCACCGACGGCGTGTACGTACGAAGCTGGAGTAGTGGACGGAGGAGGAGATTG
CTTCAGATGGAACAATGGAGTGGAGATGTTATGCTACGAGTGCGATGCTTGCAAGGCTGGTGTTCTCGAAGAGATCCGTC
TCGACTGGAGAAAGTTATCGGTTGTCAACATTCTCGTCCTCGTCCTCCTCATCGCGGTCTACGCCGCTGGTTGCTGCGCC
TTCCACAACACTCGCCACGCAGCTCATCCTTACCATCCATCTGATGATAACCGCATGACCAGAGTCCGTCCTCGTTGGGA
CTATTACTGGTGGAGATGGTGGCACGAAAAGAAAGAGCAGCTTTACTAA