Details for Arabidopsis Locus AT3G12080

Position : Chr3 ( 5`- 3847792 .. 3852138 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12080

Protein [Map View]
MASLLDSLTTRGFFTMPSISRIYSPLASSTSLTSSPSSSSSIIPSLSVLSYTHQHPHSSRFPFLVAATLDGSSAEEELDF
EEFDQYAEDNFADDYSDDEDDSIDISVLEKEARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQR
VAIVGRPNVGKSALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMTVSKSPSGVMEELNVSTTIGMEG
IPLSSREAAIARMPSMIEKQATAAVDESAVIIFVVDGQAGPSGADVEIADWLRKYYSHKYIILAVNKCESPRKGLMQASE
FWSLGFTPIPISALSGTGTGELLDLVCSGLIKLEIMENIEEEEEENYIPAIAIIGRPNVGKSSILNALVREDRTIVSPVS
GTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRAFRAIRRSDVVALVIEAMACITEQDLKIAERIE
REGKGCLVVVNKWDTIPNKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAILNQV
IREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLRTDAGFAGTPIRLLWRSRKRSDKN
GGGGGTMRMAGLTRQRNLATKRT*

DNA
ATGGCGAGTCTACTCGATTCGTTGACAACCAGAGGGTTCTTCACCATGCCCTCAATTTCTAGGATTTATTCTCCTCTAGC
TTCTTCAACTTCATTGACTTCTTCACCATCTTCCTCTTCTTCGATTATCCCATCCTTGTCAGTTCTCTCTTACACTCACC
AACACCCGCATTCCTCTCGCTTCCCTTTCCTTGTTGCAGCAACTCTGGATGGTTCCTCTGCTGAGGAAGAGCTAGATTTC
GAGGAATTCGACCAATATGCTGAAGATAACTTCGCAGATGATTATTCGGATGACGAAGACGACTCCATCGATATCTCCGT
TCTTGAGAAAGAAGCGAGAGATATCGTGAGAGATTATGCTACCACTCTGTCTCGCGAGCTCAAAATCGAGGATGAGACCA
TTGAGGGGAAGGAAACTCGTAGAAAAGGGAAAAGGCTAGCCAAAAATACACAGCAGATACCAGAGCATCTTCTCCAAAGA
GTTGCTATAGTTGGAAGGCCTAATGTCGGAAAATCAGCATTGTTCAACCGCCTTGTTGGGGAGAATAGAGCTATTGTAGT
GGATGAACCTGGAGTTACTAGGGATCGATTGTATGGTAGATCATATTGGGGTGATCAAGAGTTTGTGGTGGTAGACACCG
GAGGAGTTATGACTGTTTCAAAGTCACCATCTGGTGTCATGGAAGAGCTGAATGTGTCAACCACCATTGGCATGGAAGGT
ATTCCACTAAGCTCTAGGGAAGCAGCTATTGCAAGGATGCCTTCCATGATTGAGAAACAAGCTACAGCAGCTGTCGACGA
ATCAGCTGTTATTATTTTCGTTGTCGATGGCCAGGCAGGGCCATCAGGTGCTGATGTGGAAATTGCAGACTGGTTGCGGA
AGTACTACTCACATAAGTATATCATTCTCGCGGTGAACAAGTGTGAATCGCCACGTAAAGGACTCATGCAGGCTTCGGAA
TTTTGGTCTCTAGGGTTCACACCTATCCCTATCTCTGCATTGTCGGGAACTGGAACAGGAGAGCTGCTTGATCTTGTTTG
TTCTGGCCTAATTAAACTCGAGATCATGGAGAACATTGAAGAGGAGGAAGAAGAAAACTACATTCCTGCCATTGCAATTA
TTGGTCGGCCAAATGTTGGCAAAAGTAGCATTTTAAATGCACTTGTCCGAGAGGATAGAACAATTGTTAGCCCTGTTAGT
GGCACTACCCGTGATGCTATAGATGCAGAATTTACCGGACCAGATGGGGAGAAGTTTCGGCTTATAGATACAGCTGGGAT
CAGGAAAAAGTCATCTGTGGCTTCATCAGGCAGCACTACAGAGGCCATGTCAGTGAATCGTGCATTTCGAGCAATTCGTC
GTTCTGATGTTGTTGCCCTTGTCATTGAAGCTATGGCATGCATAACAGAGCAGGATCTGAAGATTGCAGAAAGAATAGAA
AGAGAAGGGAAAGGATGTCTGGTTGTTGTAAACAAATGGGATACAATACCGAACAAAAACCAAGAGACTGCAGCACATTA
CGAGGACGATGTTCGGGAGAAGCTCCGTTCCCTCAAATGGGCACCTATTGTTTATTCAACCGCAATAACTGGCCATAGCG
TTGACAATATTGTGGTTGCTGCTGCTACGGTTCAAAAGGAGAGATCAAGAAGACTTAGTACGGCTATATTGAACCAAGTG
ATAAGAGAAGCAGTTGCATTTAAATCCCCTCCAAGGACCCGTGGAGGCAAGCGAGGTCGCGTTTACTATTGCACCCAGGC
AGCAATAAGGCCACCGACGTTTGTTTTCTTTGTAAACGACGCAAAGCTGTTTTCGGATACGTACAGAAGGTATATGGAGA
AACAGCTACGCACTGATGCAGGCTTTGCTGGGACTCCAATTCGGCTTCTTTGGCGTAGCCGTAAAAGATCTGACAAAAAT
GGAGGAGGTGGAGGAACAATGAGAATGGCAGGCCTTACACGTCAGAGAAATCTTGCAACCAAAAGAACATAA