Details for Arabidopsis Locus AT3G12070

Position : Chr3 ( 5`- 3845211 .. 3847562 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12070

Protein [Map View]
MADKLVAGKHLRYILNLMAEKKKESFESVVMDHLRMNGAYWGLTTLALLDKLGSVSEDEVVSWVMTCQHESGGFAGNTGH
DPHVLYTLSAVQILALFDKLNILDVEKVSNYIAGLQNEDGSFSGDIWGEVDTRFSYIAICCLSILKCLDKINVKKAVDYI
VSCKNLDGGFGCSPGAESHAGQIFCCVGALAITGNLHRVDKDLLGWWLCERQDYESGGLNGRPEKLPDVCYSWWVLSSLI
MIDRVHWIEKAKLVKFILDSQDMDNGGISDRPSYTVDIFHTYFGVAGLSLLEYPGVKTIDPAYALPVHVINRILFTK*

DNA
ATGGCAGACAAGCTCGTAGCTGGCAAGCATCTTCGTTACATTCTGAATTTGATGGCAGAAAAGAAAAAAGAGAGTTTTGA
GTCTGTGGTTATGGATCATCTGAGAATGAATGGTGCATATTGGGGACTAACCACACTGGCTTTACTCGACAAGCTTGGTT
CTGTTTCCGAAGATGAAGTTGTGTCATGGGTCATGACCTGCCAGCATGAGTCTGGTGGCTTTGCCGGTAATACTGGCCAT
GATCCGCATGTTTTGTATACACTCAGTGCTGTACAAATCTTGGCCCTCTTCGACAAACTCAACATTCTTGATGTTGAAAA
AGTTTCAAATTATATTGCTGGGTTACAGAATGAAGATGGATCCTTCTCAGGAGATATATGGGGCGAAGTAGATACAAGGT
TTTCTTACATAGCTATATGCTGCCTCTCAATATTAAAATGTCTTGATAAAATCAATGTGAAGAAGGCTGTTGATTACATT
GTGAGCTGCAAAAACCTGGATGGTGGTTTTGGGTGCTCACCTGGAGCGGAGTCTCATGCAGGACAGATTTTCTGTTGTGT
GGGTGCTCTTGCTATCACCGGGAATCTCCATCGTGTTGATAAGGACTTACTTGGATGGTGGTTATGTGAAAGACAAGACT
ACGAGTCTGGAGGTTTAAATGGACGACCTGAGAAACTCCCTGATGTTTGCTATTCTTGGTGGGTCTTATCCAGCTTAATC
ATGATCGATAGAGTTCACTGGATCGAGAAAGCAAAGCTTGTCAAGTTTATCTTGGACTCTCAGGACATGGATAACGGAGG
CATCTCAGATAGACCCAGCTATACTGTTGATATCTTCCACACCTACTTTGGAGTTGCGGGGCTCTCTCTTCTCGAGTATC
CTGGAGTCAAAACAATTGATCCTGCCTACGCTTTGCCTGTCCATGTCATCAACCGGATTCTCTTCACCAAATGA