Details for Arabidopsis Locus AT3G12060

Position : Chr3 ( 5`- 3843142 .. 3845150 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12060

Protein [Map View]
MALDSVKHLPIHGVSAFSSVTVEIKSFFSTVKPRKTSTFVYAFVVTFVALTVFLAFSPSPITVALAPSISSYVLPNITVS
NSSNSSPSSLDSNFTTLRTPAPENLTAVTKNLTFESPVANGTTDTNAKTITIQFQTGHAKENISCPDNKTARDLDTHGAR
KAPLSEVLAVNSTASPKRKQRRKSSLRKVIESLKSCEFFEGDWVKDDSYPLYKPGSCNLIDEQFNCISNGRPDVDFQKLK
WKPKQCSLPRLNGGKLLEMIRGRRLVFVGDSLNRNMWESLVCILKGSVKDESQVFEAHGRHQFRWEAEYSFVFKDYNCTV
EFFASPFLVQEWEVTEKNGTKKETLRLDLVGKSSEQYKGADILVFNTGHWWTHEKTSKGEDYYQEGSTVHPKLDVDEAFR
KALTTWGRWVDKNVNPKKSLVFFRGYSPSHFSGGQWNAGGACDDETEPIKNETYLTPYMLKMEILERVLRGMKTPVTYLN
ITRLTDYRKDAHPSIYRKQKLSAEESKSPLLYQDCSHWCLPGVPDSWNEIFYAELLVKLDQLGGKRRRKALKDHRS*

DNA
ATGGCGTTGGACTCCGTTAAGCATTTGCCTATTCACGGCGTCTCCGCCTTCTCCTCCGTCACCGTCGAAATCAAAAGCTT
TTTCTCCACCGTGAAACCAAGAAAAACTTCAACTTTCGTCTACGCTTTCGTAGTAACTTTCGTTGCCTTGACTGTTTTCT
TAGCCTTTAGTCCTTCTCCCATCACAGTCGCACTCGCTCCTTCCATTTCTTCCTATGTTCTCCCTAATATCACTGTCTCG
AATTCATCCAACTCTTCACCGTCGAGTCTCGATTCTAATTTCACCACATTGCGTACACCGGCGCCGGAAAATCTCACTGC
AGTTACTAAAAACTTAACCTTTGAGTCCCCCGTCGCAAATGGGACAACGGACACAAATGCTAAAACCATCACTATTCAGT
TCCAGACCGGTCATGCAAAGGAAAACATATCGTGTCCTGACAACAAAACTGCTCGAGATTTGGACACACATGGAGCAAGG
AAAGCACCTCTGTCGGAAGTTCTAGCTGTCAATTCGACTGCTTCTCCGAAGCGAAAACAGAGAAGGAAGTCGTCGCTGAG
AAAGGTGATCGAGTCTCTGAAGAGTTGTGAGTTTTTCGAGGGAGATTGGGTCAAAGACGATTCGTATCCGCTCTACAAAC
CCGGTTCGTGTAATCTGATCGATGAACAGTTTAATTGTATCTCAAACGGAAGACCTGACGTGGATTTCCAGAAATTGAAA
TGGAAACCAAAGCAATGTTCTTTACCAAGGTTAAATGGAGGTAAATTGCTTGAGATGATTAGAGGAAGAAGGCTAGTGTT
TGTTGGAGATTCGCTGAATAGAAACATGTGGGAGTCTTTGGTTTGCATTCTTAAAGGATCAGTGAAAGACGAGAGTCAAG
TCTTTGAGGCTCATGGAAGGCATCAATTCCGTTGGGAGGCTGAGTACTCTTTCGTCTTTAAAGATTATAATTGCACTGTG
GAGTTCTTTGCATCGCCTTTCTTGGTTCAAGAATGGGAAGTTACAGAGAAGAACGGGACGAAGAAGGAGACTTTGCGGTT
AGATTTGGTCGGGAAGTCATCGGAGCAGTACAAAGGAGCGGATATTCTTGTATTCAATACCGGACATTGGTGGACTCATG
AGAAAACTTCCAAAGGGGAGGATTATTATCAAGAAGGGAGCACTGTTCACCCGAAACTCGATGTGGATGAAGCTTTCCGA
AAAGCATTGACAACTTGGGGTCGATGGGTTGATAAGAATGTGAATCCAAAGAAGTCCCTTGTTTTCTTCCGTGGTTATTC
CCCGTCACATTTCAGCGGCGGGCAATGGAATGCGGGAGGAGCATGCGATGATGAAACAGAACCGATCAAGAACGAGACTT
ACCTAACTCCTTACATGTTGAAGATGGAGATACTTGAAAGAGTTCTCAGGGGAATGAAAACACCAGTCACGTATCTCAAC
ATCACGAGGTTAACTGATTACAGGAAGGACGCTCACCCATCGATATACCGGAAACAAAAACTATCCGCAGAAGAAAGTAA
ATCACCATTGTTGTACCAAGACTGTAGCCACTGGTGTCTCCCTGGGGTGCCTGATTCTTGGAACGAAATTTTCTATGCCG
AGTTACTTGTAAAGCTTGACCAGCTTGGTGGCAAAAGACGGCGGAAAGCCCTAAAAGATCATAGGAGTTGA