Details for Arabidopsis Locus AT3G12050

Position : Chr3 ( 5`- 3839102 .. 3841466 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12050

Protein [Map View]
MAKFGEGDKRWIVEDRPDGTNVHNWHWSETNCLEWSRNFFTKQFSGVDILSGEGNLFIKVSKIEKVEGEAYVNVRKGKII
PGYELNVSLSWEGEAKDSDGKTLLKADGLVDMPYISDENADEDPEIRFSVKDEGPIGRTLKEAMVKKGKEIILEKVRVYV
EAMARGGPCRDELESKKVAPKSVAAGSATVAVEKSGAAPVVSAAAVESKVVKEKKKAKTKEGFKTITMTEKFNCRARDLY
EILMDENRWKGFTQSNAKISKDVNGPISVFDGSVTGMNLELEEGKLIVQKWRFGSWPDGLDSTVKIVFEEPQPGVTIVNL
THTDVPEEDRYGNATVVENTERGWRDLIFHRIRAVFGFGI*

DNA
ATGGCAAAGTTCGGTGAAGGTGACAAGAGATGGATCGTAGAAGACAGACCTGACGGCACCAACGTCCATAACTGGCACTG
GTCCGAAACCAATTGCCTTGAATGGTCTCGCAACTTCTTCACCAAACAATTCTCCGGCGTTGATATCCTCTCCGGCGAAG
GTAATCTTTTCATCAAGGTCAGTAAGATCGAGAAAGTCGAAGGCGAGGCTTATGTGAATGTGAGGAAGGGGAAGATTATC
CCTGGCTACGAGCTTAACGTCTCTTTATCTTGGGAAGGTGAGGCTAAAGATTCCGATGGGAAGACGCTTTTGAAAGCTGA
TGGATTGGTCGATATGCCTTATATCTCCGATGAGAATGCTGATGAAGATCCGGAGATTAGGTTTTCGGTGAAGGATGAGG
GACCGATTGGGAGGACTTTGAAGGAAGCGATGGTGAAGAAGGGGAAGGAGATTATTCTGGAGAAGGTTAGGGTTTATGTG
GAGGCTATGGCGAGAGGAGGCCCGTGTAGGGATGAATTGGAATCGAAGAAGGTTGCGCCGAAATCGGTAGCGGCTGGATC
AGCTACGGTGGCGGTGGAGAAGTCTGGTGCTGCCCCGGTGGTGTCTGCTGCTGCGGTGGAGAGTAAGGTAGTTAAGGAGA
AGAAGAAGGCGAAGACTAAGGAAGGGTTTAAGACAATTACTATGACCGAGAAGTTTAATTGCAGAGCTAGGGATTTGTAT
GAGATTTTAATGGATGAGAATCGTTGGAAAGGTTTTACGCAGAGTAATGCTAAGATTAGTAAAGATGTGAATGGTCCGAT
TAGTGTCTTTGATGGGTCTGTTACTGGAATGAATCTTGAGCTTGAAGAAGGCAAATTGATTGTTCAGAAGTGGAGATTTG
GGAGCTGGCCTGATGGTCTTGATTCAACGGTGAAGATCGTTTTCGAGGAGCCTCAACCAGGAGTCACCATTGTCAATCTT
ACTCACACTGACGTTCCTGAAGAGGACAGATACGGGAATGCGACTGTGGTGGAAAACACTGAGAGAGGATGGAGAGATCT
TATATTCCATAGGATCCGTGCAGTTTTCGGATTTGGAATATGA