Details for Arabidopsis Locus AT3G12040

Position : Chr3 ( 5`- 3835129 .. 3836833 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G12040

Protein [Map View]
MKTPARRSKRVNQEESETNVTTRVVLRTRKTNCSKTRAARVRPDYPLTRTTSESEMKLMPPEFFQIDALDLAPRLLGKFM
RRDNVVLRITEVEAYRPNDSACHGRFGVTPRTAPVFGPGGHAYVYLCYGLHMMLNIVADKEGVGAAVLIRSCSPVSGMET
IQERRGLKTDKPVLLNGPGKVGQALGLSTEWSHHPLYSPGGLELLDGGEDVEKVMVGPRVGIDYALPEHVNALWRFAVAD
TPWISAPKNTLKPL*

DNA
ATGAAAACGCCGGCTCGTCGATCGAAGCGGGTTAATCAGGAGGAATCGGAGACAAATGTTACAACCCGAGTAGTCCTACG
GACACGAAAGACCAACTGTTCCAAGACACGAGCGGCTCGGGTCAGACCCGATTACCCACTGACCCGCACCACCTCCGAGT
CCGAGATGAAGTTAATGCCTCCGGAGTTCTTTCAGATCGACGCACTTGATCTTGCGCCACGTTTGCTTGGCAAGTTCATG
AGGAGAGACAATGTTGTGCTTCGAATTACAGAGGTAGAAGCTTATAGACCAAATGATTCAGCTTGCCATGGACGATTTGG
TGTTACCCCACGGACCGCACCAGTTTTTGGACCAGGAGGACATGCTTATGTTTATCTATGTTATGGTCTTCATATGATGC
TCAATATTGTTGCTGATAAAGAAGGAGTCGGAGCTGCTGTTTTGATACGGTCTTGTTCTCCTGTTTCCGGAATGGAGACT
ATACAGGAGCGTCGTGGCCTGAAAACCGACAAACCTGTTCTTTTAAATGGACCAGGAAAGGTTGGTCAAGCGCTTGGACT
CTCAACAGAGTGGTCTCATCATCCACTTTATTCTCCTGGAGGACTGGAGCTTCTGGATGGAGGAGAAGATGTGGAGAAAG
TAATGGTTGGTCCTCGCGTTGGGATAGATTACGCATTGCCTGAACATGTGAATGCCTTGTGGAGATTTGCTGTTGCAGAC
ACTCCATGGATAAGTGCTCCTAAGAACACTCTTAAACCTCTCTAA